SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044721 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044721
Domain Number 1 Region: 43-565
Classification Level Classification E-value
Superfamily SIS domain 1.86e-213
Family Phosphoglucose isomerase, PGI 0.00000000000000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044721   Gene: ENSPTRG00000010816   Transcript: ENSPTRT00000046906
Sequence length 569
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:39549566:39585707:1 gene:ENSPTRG00000010816 transcript:ENSPTRT00000046906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALCSPQLRGSSDPRALPTLPTATSGQRPAKRRRKSPAMAALTRDPQFQKLQQWYREHG
SQLNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLMDLAKSRGVEAAR
ERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQGPLMVTE
ALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWF
LQVAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVG
FDNFEQLLSGAHWMDQHFRTTPLEKNAPILLALLGIWYINCFGCETHAMLPYDQYLHRFA
AYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIP
VQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFE
GNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPEL
DGSAQVTSHDASTNGLINFIKQQREARVQ
Download sequence
Identical sequences H2R306
ENSPTRP00000044721 XP_016789485.1.37143 ENSPTRP00000044721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]