SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044766 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044766
Domain Number 1 Region: 294-496
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-47
Family SPRY domain 0.0000369
Further Details:      
 
Domain Number 2 Region: 5-91
Classification Level Classification E-value
Superfamily RING/U-box 2.21e-26
Family RING finger domain, C3HC4 0.006
Further Details:      
 
Domain Number 3 Region: 88-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.36e-16
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044766   Gene: ENSPTRG00000003259   Transcript: ENSPTRT00000048054
Sequence length 498
Comment pep:known chromosome:CHIMP2.1.4:11:5466797:5488544:1 gene:ENSPTRG00000003259 transcript:ENSPTRT00000048054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFSVKVDIEKEVTCPICLELLTEPLSLDCGHSFCQACITTKIKESVIISRGESSCPVCQ
TRFQPGNLRPNRHLANIVERVKEVKMSPQEGQKRDVCEPHGKKLQIFCKEDGKVICWVCE
LSPEHQGHQTFRINEVVKECQEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIER
QKILKGFNEMRVILDNEEQRELQKLEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQRR
LRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRVPDLSGMLQVLKELTDVQYYW
VDVMLNPGSATSNVAISVDQRQVKTVRTCTFKNSNPCDFSAFGVFGCQYFSSGKYYWEVD
VSGKIAWILGVHSKISSLNKRKSSGFAFDPSVNYSKVYSKYRPQYGYWVIGLQNTCEYNA
FEDSSSSDPKVLTLFMAVPPCRIGVFLDYEAGIVSFFNVTNHGALIYKFSGCHFSRPAYP
YFNPWNCLVPMTVCPPSS
Download sequence
Identical sequences B0F4N0
9598.ENSPTRP00000044766 ENSPTRP00000044766 ENSPTRP00000044766 NP_001106867.1.37143 XP_009458047.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]