SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044778 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044778
Domain Number 1 Region: 5-322
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.87e-123
Family Transglutaminase core 0.00000000957
Further Details:      
 
Domain Number 2 Region: 344-463
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.37e-26
Family Transglutaminase, two C-terminal domains 0.0017
Further Details:      
 
Domain Number 3 Region: 465-562
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.94e-25
Family Transglutaminase, two C-terminal domains 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044778   Gene: ENSPTRG00000006990   Transcript: ENSPTRT00000012896
Sequence length 567
Comment pep:known_by_projection chromosome:CHIMP2.1.4:15:40290312:40316387:-1 gene:ENSPTRG00000006990 transcript:ENSPTRT00000012896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQEDDVYLPSEILLQEYIMRDYGFVYKGHERFVTSWPWNYGQFEEDIIDICFEILNKSL
YYLKNPAKDCSQRNDVVYVCRVVSAMINSNDDNGVLQGNWGEDYSKGVSPLEWNGSVAIL
QQWSARGGQPVKYGQCWVFASVMCTVMRCLGVPTRVVSNFRSAHNVDRNLTIDTYYDRNA
EMLSTQKRDKIWNFHVWNECWMIRKDLPPGYNGWQVLDPTPQQTSSGLFCCGPASVKAIR
EGDVHLAYDTPFVYAEVNADEVIWLLGDGQAQEILAHNTSSIGKEISTKMVGSDQRQSIT
SSYKYPEGSPEERAVFMKASRKMLGPQRASLPFLDLLESGGLRDQPAQLQLHLARIPEWG
QDLQLLLHIQRVPDSTHPRGPIRLVVRFCAQALLHGGGTQKPFWRHTVRMNLDFGKETQW
PLLLPYSNYRNKLTDEKLIRVSGIAEVEETGRSMLVLKDICLEPPHLSIEVSERAEVGKA
LRVHVTLTNTLMVALSSCTMVLEGSGLINGQIAKDLGTLVAGHTLQIQLDLYPTKAGPRQ
LQVLISSNEVKEIKGYKDIFVTVAGAP
Download sequence
Identical sequences ENSPTRP00000044778 ENSPTRP00000044778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]