SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044822 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044822
Domain Number 1 Region: 47-141
Classification Level Classification E-value
Superfamily Immunoglobulin 3.49e-16
Family V set domains (antibody variable domain-like) 0.0049
Further Details:      
 
Domain Number 2 Region: 161-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000188
Family I set domains 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044822   Gene: ENSPTRG00000001164   Transcript: ENSPTRT00000044967
Sequence length 282
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:119505736:119578494:1 gene:ENSPTRG00000001164 transcript:ENSPTRT00000044967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEP
DIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNV
QLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVV
WASQIDQGANFSEVSNTSFELNSENVTMKVVSVLYNATINNTYSCMIENDIAKATGDIKV
TESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Download sequence
Identical sequences H2R332
XP_003308340.1.37143 ENSPTRP00000044822 ENSPTRP00000044822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]