SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044847 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044847
Domain Number 1 Region: 176-356
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.72e-27
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 2 Region: 30-156
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.34e-16
Family Laminin G-like module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044847   Gene: ENSPTRG00000007305   Transcript: ENSPTRT00000013481
Sequence length 2298
Comment pep:known_by_projection chromosome:CHIMP2.1.4:15:73229737:73268829:-1 gene:ENSPTRG00000007305 transcript:ENSPTRT00000013481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSGPRNPLPAPGLALALTLTMLARLASALQFSSQPEALLLLAAGPADHLLLQLYSGRLQ
VRLVLGQEELRLQTPAETLLSDSIPHTVVLTVVEGWATLSVDGFLNASSAVPGAPLEVPY
GLFVGGTGTLGLPYLRGTSRPLRGCLHAATLNGRSLLRPLTPDVHEGCAEEFSASDDVAL
GFSGPHSLAAFPAWGTQDEGTLEFTLTTQSQQAPLAFQAGGRRGDFIYVDIFEGHLRAVV
EKGQGTVLLHNSVPVADGQPHEVSVHINAHRLEISVDQYPTHTSNRGVLSYLEPQGSLLL
GGLDAEASRHLQEHRLGLTPEATNASLLGCMEDLSVNGQRRGLREALLTRNMAAGCRLEE
EEYEDDAYGHYEAFSTLAPEAWPAMELPEPCVPEPGLPAVFANFTQLLTISPLVVAEGGT
AWLEWRHVQPTLDLMEAELRKSQVLFSVTRGARHGELELDIPGAQARKMFTLLDVVNRKA
RFIHDGSEDTSDQLVLEVSVTARVSMPSCLRRGQTYLLPIQVNPVNDPPHIIFPHGSLMV
ILEHTQKPLGPEVFQAYDPDSACEGLTFQVLGTSSGLPVERRDQPGEPATEFSCRELEAG
SLVYVHRGGPAQDLTFRVSDGLQASPPATLKVVAIRPAIQIHRSTGLRLAQGSAMPILPA
NLSVETNAVGQDVSVLFRVTGALQFGELQKQGAGGVEGAEWWATQAFHQRDVEQGRVRYL
STDPQHHAYDTVENLALEVQVGQEILSNLSFPVTIQRATVWMLRLEPLHTQNTQQEALTT
AHLEATLEEAGPSPPTFHYEVVQAPRKGNLQLQGTRLSDGQGFTQDDIQAGRVTYGATAR
ASEAVEDTFHFRVTAPPYFSPLYTFPIHIGGDPDAPVLTNVLLVVPEGGEGVLSADHLFV
KSLNSASYLYEVMERPRHGRLAWRGTQDKTTVVTSFTNEDLLRGRLVYQHDDSETTEDDI
PFVATRQGESSGDMAWEEVRGVFRVAIQPVNDHAPVQTISRIFHVARGGRRLLTTDDVAF
SDADSGFADAQLVLTRKDLLFGSIVAVDEPTRPIYRFTQEDLRNRRVLFVHSGADRGWIQ
LQVSDGQHQATALLEVQASEPYLRVANGSSLVVPQGGQGTIDTAVLHLDTNLDIRSGDEV
HYHVTAGPRWGQLLRAGQPATAFSQQDLLDGAVLYSHNGSLSPRDTLAFSVEAGPVHTDA
TLQVTIALEGPLAPLKLVRHKKIYVFQGEAAEIRRDQLEAAQEAVPPADIVFSVKSPPSA
GYLVMVSRGALADEPPSLDPLQSFSQEAVDMGRVLYLHSRPEAWSDAFSLDVASGLGAPL
EGVLVELEVLPAAIPLETQNFSVPEGGSLTLAPPLLRVSGPYFPTLLGLSLQVLEPPQHG
ALQKEDGPQARTLSAFSWREVEEQLIRYVHDGSETLTDSFVLMATASKMDRQSHPVAFTV
TVLPVNDQPPILTTNTGLQMWEGATAPIPAEALRSTDGDSGSEDLVYTIEQPSNGRVVLR
GAPGTEVRSFTQAQLDGRLVLFSHRGSLDGGFRFRLSDGEHTSSGHFFRVTAQKQVLLSL
EGSRTLTVCPGSVQPLSSQTLRASSSAGTDPQLLLYRVVRGPQLGRLFHAQQDSTGEALV
NFTQAEVYAGNILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRP
SHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSE
EPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFCAHLQGPAGASVAGPQTSEAFAIT
VRDVNERPPQPQASVPLRLTRGSRAPISRAQLSVVDPDSAPGEIEYEVQRAPHNGFLSLV
GGGLGPVTRFTQADVDSGRLAFVANGSSVAGIFQLSMSDGASPPLPMSLAVDILPSAIEV
QLRAPLEVPQALGRSSLSQQQLRVVSDREEPEAAYRLIQGPQYGHLLVGGRPASAFSQLQ
IDQGEVVFAFTNFSSSHDHFRVLALARGVNASAVVNVTVRALLHVWAGGPWPQGATLRLD
PTVLDAGELANRTGSVPRFRLLEGPRHGRVVRVPRARTEPGGSQLVEQFAQQSKGDGRLG
LRVGRPEGRAPGPAGDSLTLELWAQGVPPAVASLDFATEPYNAARPYSVALLSVPEAART
EAGKPESSTPTGEPGPMASSPEPAVAKGGFLSFLEANMFSVIIPMCLVLLLLALILPLLF
YLRKRNKTGKHDVQVLTAKPRNGLAGDTETFRKVEPGQAIPLTAVPGQGSPPGGQPDPEL
LQFCRTANPALKNGQYWV
Download sequence
Identical sequences ENSPTRP00000044847 ENSPTRP00000044847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]