SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000045194 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000045194
Domain Number 1 Region: 385-495
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-19
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 221-283
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000708
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 501-559
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000118
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 4 Region: 561-622
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 5 Region: 629-695
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000236
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 280-334
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000288
Family Spermadhesin, CUB domain 0.0064
Further Details:      
 
Domain Number 7 Region: 168-219
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000628
Family Spermadhesin, CUB domain 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000045194
Domain Number - Region: 337-388
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000216
Family Complement control module/SCR domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000045194   Gene: ENSPTRG00000007973   Transcript: ENSPTRT00000045129
Sequence length 768
Comment pep:known_by_projection chromosome:CHIMP2.1.4:16:30014755:30039500:-1 gene:ENSPTRG00000007973 transcript:ENSPTRT00000045129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPRAQHPPPPQLLFLILLSCPWIQGLPLKEEEILPEPGSETPTVASEALAELLHGALL
RRGPEMGYLPGSDPDPTLATPPAGQTLAVPSLPRATEPGTGPLTTAVTPNGVRGAGPTAP
ELLTPPPGTTAPPPPSPASPGPPLGPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEG
EGYVESPDLGSPVSRTLGLLDCTYSIHVYPGYGIEIQYLLSCGFPPRPAHGDVSVTDLHP
GGTATFHCDSGYQLQGEETLICLNGTRPSWNGETPSCMASCGGTIHNATLGRIVSPEPGG
AVGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRDPEYRPGALLPLLCLPGYALEPPGP
PNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLSPDWPQSYSPGQDCVWGLHVQEE
KRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQPRRRLLSSGPDLTLQFQAPPGP
PNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHGDLIRGTVLTYQCEPGYELLGSD
ILTCQWDLSWSAAPPACQKIMTCADPGEIANGHRTASDAGFPVGSHVQYRCLPGYSLEGA
AMLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPENGYQTLYKHHYQAGESLRFFCYEG
FELIGEVTITCVPGHPSQWTSQPPLCKVTQTTDPSRQLEGGNLALAILLPLGLVIVLGSG
VYIYYTKLQGKSLFGFSGSHSYSPITVESDFSNPLYEAGDTREYEVSI
Download sequence
Identical sequences ENSPTRP00000045194 ENSPTRP00000045194 9598.ENSPTRP00000045194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]