SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000045213 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000045213
Domain Number 1 Region: 5-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000014
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000045213   Gene: ENSPTRG00000007312   Transcript: ENSPTRT00000046996
Sequence length 115
Comment pep:known_by_projection chromosome:CHIMP2.1.4:15:73493719:73567103:-1 gene:ENSPTRG00000007312 transcript:ENSPTRT00000046996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCIENYTGARCEEVFLPGSSIQTKSN
LFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEEH
Download sequence
Identical sequences H2R3B1
ENSPTRP00000045213 9598.ENSPTRP00000045213 ENSPTRP00000045213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]