SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000045409 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000045409
Domain Number 1 Region: 155-357
Classification Level Classification E-value
Superfamily vWA-like 5.15e-56
Family Integrin A (or I) domain 0.00035
Further Details:      
 
Domain Number 2 Region: 841-1046
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.49e-28
Family Laminin G-like module 0.06
Further Details:      
 
Domain Number 3 Region: 649-822
Classification Level Classification E-value
Superfamily Fibronectin type III 1.24e-20
Family Fibronectin type III 0.0009
Further Details:      
 
Domain Number 4 Region: 379-538
Classification Level Classification E-value
Superfamily Fibronectin type III 4.11e-19
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 5 Region: 556-644
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000185
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 6 Region: 32-103
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000105
Family Fibronectin type III 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000045409   Gene: ENSPTRG00000013734   Transcript: ENSPTRT00000049058
Sequence length 1284
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:60679192:60718911:1 gene:ENSPTRG00000013734 transcript:ENSPTRT00000049058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGAPAHLGLCLWLWLGATLGREQVQASGLLRLSVLPEDRLQMKWRESEGSGLGYLVQV
KPMAGDSEQEVILTTKTPKATVGGLSPSKGYTLQIFELTGSGRFLLARREFVIEDLKSSS
LDRSSQRPLGSGAPEPTPSHMGSPDPEQASEPQVAFTPSQDPPTPAGPQFRCLPPVPADM
VFLVDGSWSIGHSHFQQVKDFLASVIAPFEIGPDKVQVGLTQYSGDAQTEWDLNSLSTKE
QVLAAVRRLRYKGGNTFTGLALTHVLGQNLQPVAGLRPEAAKVVILVTDGKSQDDVHTAA
RVLKDLGVNVFAVGVKNADEAELRLLASPPRDITVHSVLDFLQLGTLAGLLSRLICQRLQ
GGSPRQGPAAAPALDTLPAPTSLVLSQVTSSSIRLSWTPAPRHPLKYLIVWRASRGGTPR
EVVVEGPAASTELHNLASRTEYLVSVFPIYEGGVGEGLRGLVTTAPLPPPRALTLAAVTP
RTIHLTWQPSAGATHYLVRCSPASPKGEEEEREVQVGRPEVLLDGLEPGRDYEVSVQSLR
GPEGSEARGIHARTPALAPPRHLGFSDVSHDAARVFWEGAPRPVRLVRVTYVSSEGGHSG
QTEAPGNATSATLGPLSSSTTYTVRVTCLYPGGGSSTLTGRVTTKKAPSPSQLSVTELPG
DAVQLAWVAAAPSGVLVYQITWTPLGEGKAHEISVPGNLGTAVLPGLGRHTEYNVTILAY
YRDGARSDPVSLCYTPSTVSRSPPSNLALASETPDSLQVSWTPPLGHVLHYWLTYAPASG
LGPEKSVSVPAPRSHVTLPDLQAATKYRVLLSAIYAAGRSEAVSAMGQTACPALRPDGSL
PGFDLMVAFSLVEKAYASIRGVAMEPSAFGGTPTFTLFKDAQLTRRVSDVLPAPLPPEHT
IVFLLRLLPETPREAFALWQMTAEDFQPLLGVLLDAGRKSLTYFHRDPRAALQEATFDPQ
EVRKIFFGSFHKVHVAVGRSKVRLYVDCRKVAERPLGEMSSPPAAGFVTLGRLAKARGPR
SSSAVFQLQMLQIVCSDTWADEDRCCELPASRDGETCPAFVSACSCSSETPGPPGPQGPP
GLPGRNGTPGEQGFPGPRGPPGVKGEKGDHGLPGLQGHPGHQGIPGRVGLQGPKGMRGLE
GTAGLPGPPGPRGFQGMAGARGTSGERGPPGTVGPTGLPGPKGERGEKGEPQSLATLYQL
VSQASHVSKFDSFHKNTRPPMPILEQKLEPGTEPLGSPGTRSKALVPGEWGRGGRHLEGR
GEPGAVGQTGSPGQQGASTQGLWE
Download sequence
Identical sequences ENSPTRP00000045409 ENSPTRP00000045409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]