SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000045503 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000045503
Domain Number 1 Region: 216-378
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 8.93e-43
Family Pentapeptide repeats 0.00024
Further Details:      
 
Domain Number 2 Region: 89-189
Classification Level Classification E-value
Superfamily POZ domain 3.93e-28
Family Tetramerization domain of potassium channels 0.0092
Further Details:      
 
Domain Number 3 Region: 2-76
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.00000419
Family Doublecortin (DC) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000045503   Gene: ENSPTRG00000022143   Transcript: ENSPTRT00000046785
Sequence length 389
Comment pep:novel chromosome:CHIMP2.1.4:17:6923036:6924467:1 gene:ENSPTRG00000022143 transcript:ENSPTRT00000046785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRVTLFLNGSPKNGKVVAVYGTLSDLLSVASSKLGIKATSVYNGKGGLIDDIALIRDDD
VLFVCEGEPFIDPQTDSKPPEGLLGFHTDWLTLNVGGRYFTTTRSTLVNKEPDSMLAHMF
KDKVVWGNKQDHRGAFLIDRSPEYFEPILNYLRHGQLIVNDGINLLGVLEEARFFGIDSL
IEHLEVAIKNSQPPEDHSPISRKEFVRFLLATPTKSELRCQGLNFSGADLSRLDLRYINF
KMANLSRCNLAHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG
LKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDLENCDLSGCDL
QEANLRGSNVKGAIFEEMLTPLHMSQSVR
Download sequence
Identical sequences ENSPTRP00000045503 ENSPTRP00000045503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]