SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000045659 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000045659
Domain Number 1 Region: 216-414
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.2e-48
Family Reprolysin-like 0.0002
Further Details:      
 
Domain Number 2 Region: 431-507
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.12e-19
Family Blood coagulation inhibitor (disintegrin) 0.00053
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000045659
Domain Number - Region: 662-689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000045659   Gene: ENSPTRG00000009284   Transcript: ENSPTRT00000048595
Sequence length 747
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:12622068:12644393:-1 gene:ENSPTRG00000009284 transcript:ENSPTRT00000048595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTQGPAGALRWGDLPQLGGPGAPEVTEPSRLVRESSGGEVRKQQLDTRVRQEPPGGPPVH
LAQVSFVIPAFNSNFTLDLELNHHLLSSQYVERHFSREGTTQHSTGAGDHCYYQGKLRGN
PHSFAALSTCQGLHGVFSDGNLTYIVEPQEVAGPWGAPQGPLPHLIYRTPLLPDPLGCRE
PGCLFALPAQSAPPNRPRLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVVLT
SNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPE
PSDATHLFSGRTFQSTSSGAAYVGGICSLSHGGGVNEYGNMGAMAVTLAQTLGQNLGMMW
NKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSIDEYNQFLQEGGGSCLFNKPLKLL
DPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLTHDAMCSDGLCCRRCKYEPRGVS
CREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQGRCYGGRCKTRDRQCQVLWGHAA
ADRFCYEKLNVEGTERGSCGRKGSGWVQCSKQDVLCGFLLCVNISGAPRLGDLVGDISSV
TFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPASAFNFSTCPGSGE
RRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSPPTGETERYKGPSGTNIIIGSIAG
AVLVAAIVLGGTGWGFKNIRRGRSGGA
Download sequence
Identical sequences ENSPTRP00000045659 ENSPTRP00000045659 9598.ENSPTRP00000045659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]