SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000045752 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000045752
Domain Number 1 Region: 143-479
Classification Level Classification E-value
Superfamily Subtilisin-like 1.57e-88
Family Subtilases 0.0000000252
Further Details:      
 
Domain Number 2 Region: 474-619
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.91e-36
Family Proprotein convertase P-domain 0.00078
Further Details:      
 
Domain Number 3 Region: 53-133
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000116
Family Prohormone convertase 1 pro-domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000045752   Gene: ENSPTRG00000004321   Transcript: ENSPTRT00000044988
Sequence length 785
Comment pep:known chromosome:CHIMP2.1.4:11:115107624:115135441:-1 gene:ENSPTRG00000004321 transcript:ENSPTRT00000044988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKGRQKVPHLDAPLGLPTCLWLELAGLFLLVPWVMGLAGTGGPDGQGPGGPSWAVHLES
LEGDGEEETLEQQADALAQAAGLVNAGRIGELQGHYLFVQPAGHRPALEVEAIRQQVEAV
LAGHEAVRWHSEQRLLRRAKRSVHFNDPKYPQQWHLNNRRSPGRDINVTGVWERNVTGRG
VTVVVVDDGVEHTIQDIAPNYSPEGSYDLNSNDPDPMPHPDVENGNHHGTRCAGEIAAVP
NNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQINDIYSCSWGPDDDGKTVDGP
HQLGKAALQHGVIAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGRM
PFYAEECASMLAVTFSGGDKMLRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALML
QVRPCLTWRDVQHIIVFTATRYEDRRAEWVTNEAGFSHSHQHGFGLLNAWRLVNAAKIWT
SVPYLASYVSPVLKENKAIPQSPHSLEVLWNVSRMDLEMSGLKTLEHVAVTVSITHPRRG
SLELKLFCPSGMMSLIGAPRSMDSDPNGFNDWTFSTVRCWGERARGTYRLVIRDVGDESF
QVGILRQWQLTLYGSVWSPVDIRDRQRLLESAMSGKYLHDDFALPCPPGLKIPEEDGYTI
TPNTLKTLVLVGCFTVFWTVYYMLEVYLSQRNVASNQVCRSAPCHWPHRSRKAKEEGTEL
ESVPLCSSKDPDEVETESRGPPTTSDLLAPDLLEQGDWSLSQNKSALDCPHQHLDLLHRK
EEQIC
Download sequence
Identical sequences K7AWX9
ENSPTRP00000045752 ENSPTRP00000045752 9598.ENSPTRP00000045752 XP_003820125.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]