SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000046677 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000046677
Domain Number 1 Region: 14-105
Classification Level Classification E-value
Superfamily SH2 domain 1.38e-38
Family SH2 domain 0.00036
Further Details:      
 
Domain Number 2 Region: 108-192
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-23
Family SH3-domain 0.078
Further Details:      
 
Domain Number 3 Region: 106-179
Classification Level Classification E-value
Superfamily CATH 0.00000000000000314
Family CATH 0.01
Further Details:      
 
Domain Number 4 Region: 222-300
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000447
Family SH3-domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000046677   Gene: ENSPTRG00000014094   Transcript: ENSPTRT00000050467
Sequence length 303
Comment pep:known chromosome:CHIMP2.1.4:22:19588593:19621473:1 gene:ENSPTRG00000014094 transcript:ENSPTRT00000050467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
ENE
Download sequence
Identical sequences A0A096NS79 A0A2J8RZE4 A0A2K5JNX9 A0A2K5N8R6 A0A2K5YVD1 A0A2K6C7G7 A0A2K6M0Y3 A0A2K6RHN4 F6VK11 G1QGU0 G7PHA6 H2R472 P46109
ENSPANP00000015899 ENSP00000346300 ENSP00000396646 ENSMMUP00000026970 ENSNLEP00000000117 ENSP00000346300 ENSNLEP00000000117 2lqn_A 2lqw_A ENSP00000346300 ENSP00000396646 ENSPTRP00000046677 HR6365 NYSGXRC-13016b hso002001392.3 gi|4885153|ref|NP_005198.1| NP_001244412.1.72884 NP_005198.1.87134 NP_005198.1.92137 XP_002834682.1.23681 XP_003281479.1.23891 XP_003806931.1.60992 XP_005567948.1.63531 XP_010367285.1.97406 XP_011738063.1.29376 XP_011802700.1.43180 XP_011842726.1.47321 XP_011942729.1.92194 XP_016795233.1.37143 XP_016802822.1.37143 XP_017738066.1.44346 XP_525530.2.37143 ENSPTRP00000046677 ENSMMUP00000026970 9544.ENSMMUP00000026970 9598.ENSPTRP00000046677 9600.ENSPPYP00000013413 9606.ENSP00000346300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]