SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000046705 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000046705
Domain Number 1 Region: 750-916
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.86e-47
Family MAM domain 0.00024
Further Details:      
 
Domain Number 2 Region: 238-329
Classification Level Classification E-value
Superfamily Immunoglobulin 5.92e-17
Family I set domains 0.0051
Further Details:      
 
Domain Number 3 Region: 343-442
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000474
Family I set domains 0.043
Further Details:      
 
Domain Number 4 Region: 438-540
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000518
Family I set domains 0.031
Further Details:      
 
Domain Number 5 Region: 535-631
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000729
Family I set domains 0.032
Further Details:      
 
Domain Number 6 Region: 48-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000117
Family I set domains 0.069
Further Details:      
 
Domain Number 7 Region: 131-217
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000811
Family I set domains 0.03
Further Details:      
 
Domain Number 8 Region: 194-240,632-740
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000006
Family Fibronectin type III 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000046705   Gene: ENSPTRG00000018124   Transcript: ENSPTRT00000043406
Sequence length 955
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:38135603:38202869:-1 gene:ENSPTRG00000018124 transcript:ENSPTRT00000043406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQC
LVTGHPRPQVRWTKTAGSASDKFQETSVFNETLRIERIARTQGGRYYCKAENGVGVPAIK
SIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDIYEPLYTQGETKVLKLKNLRPQDYASYTCQVSVRNVCGIPDKAITFRLTNTTAPP
ALKLSVNETLVVNPGENVTVQCLLTGGDPLPQLQWSHGPGPLPLGALAQGGTLSIPSVQA
RDSGYYNCTATNNVGNPAKKTVNLLVRSMKNATFQITPDVIKESENIQLGQDLKLSCHVD
AVPQEKVTYQWFKNGKPARMSKRLLVTRNDPELPAVTSSLELIDLHFSDYGTYLCMASFP
GAPVPDLSVEVNISSETVPPTISVPKGRAVVTVREGSPAELQCEVRGKPRPPVLWSRVDK
EAALLPSGLPLEETPDGKLRLERVSRDMSGTYRCQTARYNGFNVRPREAQVQLNVQFPPE
VEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVWRFKGQLLPPPPVVPAAAEAPDHAEL
RLDAVTRDSSGSYECSVSNDVGSAACLFQVSAKAYSPEFYFDTPNPTRSHKLSKNYSYVL
QWTQREPDAVDPVLNYRLSIRQLNQHNAVVKAIPVRRVEKGQLLEYILTDLRVPHSYEVR
LTPYTTFGAGDMASRIIHYTEPINSPNLSDNTCHFEDEKICGYTQDLTDNFDWTRQNALT
QNPKRSPNTGPPTDISGTPEGYYMFIETSRPRELGDRARLVSPLYNASAKFYCVSFFYHM
YGKHIGSLNLLVRSRNKGALDTHAWSLSGNKGNVWQQAHVRISPSGPFQIIFEGVRGPGY
LGDIAIDDVTLKKGECPRKQTDPNKVVVMPGSGAPCQSSPQLWGPMAIFLLALQR
Download sequence
Identical sequences ENSPTRP00000046705 ENSPTRP00000046705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]