SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000046931 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000046931
Domain Number 1 Region: 489-792
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.77e-102
Family PDEase 0.000000602
Further Details:      
 
Domain Number 2 Region: 275-466
Classification Level Classification E-value
Superfamily GAF domain-like 6.98e-48
Family GAF domain 0.000029
Further Details:      
 
Domain Number 3 Region: 118-267
Classification Level Classification E-value
Superfamily GAF domain-like 1.59e-19
Family GAF domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000046931   Gene: ENSPTRG00000018787   Transcript: ENSPTRT00000050003
Sequence length 807
Comment pep:known chromosome:CHIMP2.1.4:6:167168138:167510086:-1 gene:ENSPTRG00000018787 transcript:ENSPTRT00000050003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGASFALAAAAALLFGSDMEDGPSNNASCFRRLTECFLSPSLTDEKVKAYLSLHPQVLDE
FVSESVSAETVEKWLKRKNNKSEDESAPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDN
QLLLYELSSIIKIATKADGFALYFLGECNNSLCIFTPPGIKEGKPRLIPAGPITQGTTVS
AYVAKSRKTLLVEDILGDERFPGGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGK
EAFCLSHQEVATANLAWASVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLE
HIMIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAG
QVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSA
FSKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWQGLMQF
TLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRV
PYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPL
AALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNR
KQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDE
MKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQW
EKVIRGEETATWISSPSVAQKAAASED
Download sequence
Identical sequences ENSPTRP00000046931 9598.ENSPTRP00000046931 ENSPTRP00000046931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]