SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047082 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047082
Domain Number 1 Region: 249-495
Classification Level Classification E-value
Superfamily Kelch motif 7.85e-35
Family Kelch motif 0.011
Further Details:      
 
Domain Number 2 Region: 428-628
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 2.75e-18
Family Galactose oxidase, central domain 0.033
Further Details:      
 
Domain Number 3 Region: 17-156
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.45e-17
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047082   Gene: ENSPTRG00000022979   Transcript: ENSPTRT00000046232
Sequence length 735
Comment pep:known chromosome:CHIMP2.1.4:7:132815010:132979332:1 gene:ENSPTRG00000022979 transcript:ENSPTRT00000046232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGAVAAAPECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSESNYPPQYLIL
KLERPAIVQNITFGKYEKTHVCNLKKFKVFGGMNEENMTELLSSGLKNDYNKETFTLKHK
IDEQMFPCRFIKIVPLLSWGPSFNFSIWYVELSGIDDPDIVQPCLNWYSKYREQEAIRLC
LKHFRQHNYTEAFESLQKKTKIALEHPMLTDIHDKLVLKGDFDACEELIEKAVNDGLFNQ
YISQQEYKPRWSQIIPKSTKGDGEDNRPGMRGGHQMVIDVQTETVYLFGGWDGTQDLADF
WAYSVKENQWTCISRDTEKENGPSARSCHKMCIDIQRRQIYTLGRYLDSSVRNSKSLKSD
FYRYDIDTNTWMLLSEDTAADGGPKLVFDHQMCMDSEKHMIYTFGGRILTCNGSVDDSRA
SEPQFSGLFAFNCQCQTWKLLREDSCNAGPEDIQSRIGHCMLFHSKNRCLYVFGGQRSKT
YLNDFFSYDVDSDHVDIISDGTKKDSGMVPMTGFTQRATIDPELNEIHVLSGLSKDKEKR
EENVRNSFWIYDIVRNSWSCVYKNDQAAKDNPTKSLQEEEPCPRFAHQLVYDELHKVHYL
FGGNPGKSCSPKMRLDDFWSLKLCRPSKDYLLRHCKYLIRKHRFEEKAQMDPLSALKYLQ
NDLYITVDHSDPEETKEFQLLASALFKSGSDFTALGFSDVDHTYAQRTQLFDTLVNFFPD
SMTPPKGNLVDLITL
Download sequence
Identical sequences A0A2I3H3L1 A0A2I3T2U5 A0A2J8U471 Q5RB35
ENSNLEP00000015692 ENSPTRP00000047082 ENSPTRP00000047082 ENSNLEP00000015692 9598.ENSPTRP00000047082 NP_001125592.1.23681 XP_003261395.1.23891 XP_003813510.1.60992 XP_519385.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]