SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047302 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047302
Domain Number 1 Region: 92-318
Classification Level Classification E-value
Superfamily L domain-like 5.56e-37
Family Leucine rich effector protein YopM 0.039
Further Details:      
 
Domain Number 2 Region: 641-751
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-25
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047302   Gene: ENSPTRG00000022201   Transcript: ENSPTRT00000041370
Sequence length 761
Comment pep:known_by_projection chromosome:CHIMP2.1.4:X:115712462:115837457:-1 gene:ENSPTRG00000022201 transcript:ENSPTRT00000041370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASQGGGGNSAGGGCGGGGSSGGCGTAGGGGGGAGGGGGCGGTLVVPIPVPTLFGQPFP
GPPWKPGSSQLKHTSHSFDRASNEGGSGIVNVSGIIICDFPGSGDILDTTQPDLSRNRFT
EIPSDVWLFAPLETLNLYHNCIKTIPEAIKNLQMLTYLNISRNLLSTLPKYLFDLPLKVL
VVSNNKLVSIPEEIGKLKDLMELDISCNEIQVLPQQMGKLHSLRELNIRRNNLHVLPDEL
GDLPLVKLDFSCNKVTEIPVCYRKLHHLQVIILDNNPLQVPPAQICLKGKVHIFKYLNIQ
ACCRMDKKPDSLDLPSLSKRMPSQPLTDSMEDFYPNKNHGPDSGIGSDNGEKRLSTTEPS
DDDTVSLHSQVSESNREQTSRNDSHIIGSKTDSQKDQEVYDFVDPNTEDVAVPEQGNAHI
GSFVSFFKGKEKCSEKSRKNEELGDEKRLEKEQLLAEEEDDDLKEVTDLRKIAAQLLQQE
QKNRILNHSTSVMRNKPKQTVECEKSVSADEVNSPLSPLTWQPLENQKDQIDEQPWPESH
PIIWQSEERRRSKQIRKEYFKYKSMRKSSSGNENDEQDSDNANMSPQSPVSSEEYDRTDG
FSHSPFGLKPRSAFSRSSRQEYGAADPGFTMRRKMEHLREEREQIRQLRNNLESRLKVIL
PDDIGAALMDGVVLCHLANHIRPRSVASIHVPSPAVPKLSMAKCRRNVENFLDACKKLGV
SQERLCLPHHILEERGLVKVGVTVQALLELPTTKASQLSMA
Download sequence
Identical sequences ENSPTRP00000047302 ENSPTRP00000047302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]