SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047330 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047330
Domain Number 1 Region: 601-819
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000227
Family Armadillo repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047330   Gene: ENSPTRG00000028232   Transcript: ENSPTRT00000054937
Sequence length 830
Comment pep:known_by_projection chromosome:CHIMP2.1.4:X:103180220:103184192:1 gene:ENSPTRG00000028232 transcript:ENSPTRT00000054937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGAEIESGAQVKPEKKPAEEVVGGAEIENDVPLVVRPKVRTQAQIMPGARPKNKSKVMP
GASTKVETSAVGGARPKSKAKAIPVSRFKEEAQMWAQPRFGAERLSKTERNSQTNIIASP
LVSTDSVLVAKTKYLSEDRELVNTDTESFPRRKAHYQAGFQPSFRSKEETNMGSWCCPRP
TSKQEASPNSDFKWVDQSVSSLFWSGDEVTAKFHPGNRVKENEQLLEPAAETREEDRLAA
EKEGIVGSWFGAREETIRREAGSCSKSSPKAEEEEVIIGSWFWEEEASLEAVAGVGFESK
PGTEEEEITVGSWFWPEEEASIQAGSQAVEEMESETEEETIFGSWFWDGKEVGEEAGPCC
VSKPEDDEEMIVESWFWSRDKAIKETGTVATCESKPENEEGAIVGSWFEAEDEVDNRTDN
GSNCGSRTLADEDEAIVGSWFWAGDEAHFESNPSPVFRAICRSTCSVEQEPDPSRRPQSW
EEVTVQFKPGPWGRVGFPSISPFRFPKEAASLFCEMFGGKPRNMVLSPEGEDQESLLQPD
QPSPEFPFQYDPSYRSVQEIREHLRAKESTEPESSSCNCIQCELKIGSEEFEELLLLMEK
IRDPFIHEISKIAMGMRSASQFTRDFIRDSGVVSLIETLLNYPSSRVRTSFLENMILMAP
PYPNLNIIQTYICKVCEETLAYSVDSPEQLSGIRMIRHLTTTTDYHTLVANYMSGFLSLL
ATGNAKTRFHVLKMLLNLSENLFMTKELLSAEAVSEFIGLFNREETNDNIQIVLAIFENI
GNNIKKETVFSDDDFNIEPLISAFHKVEKFAKELQGKTDNQNDPEGDQEN
Download sequence
Identical sequences ENSPTRP00000047330 ENSPTRP00000047330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]