SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047622 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047622
Domain Number 1 Region: 299-544
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.23e-89
Family Eukaryotic proteases 0.0000353
Further Details:      
 
Domain Number 2 Region: 209-305
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-18
Family Hepsin, N-terminal domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000047622
Domain Number - Region: 188-212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000107
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047622   Gene: ENSPTRG00000004330   Transcript: ENSPTRT00000008045
Sequence length 552
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:115817142:115844555:-1 gene:ENSPTRG00000004330 transcript:ENSPTRT00000008045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERDSHGNASPARTPSAGASPAQASPAQASPAGTPPGRASPAQASPAGTPPGRASPAQAS
PAQASPAQASPARASPALASPSRSSSGRSSSARSASVTTSPTRVYLVRATPVRAVPVRSS
PARSAPATRATRESSGTSLPKFTWREGQKRLPFIGCVLLLIALVASLIILFQFWRGHTGI
RYKEQRESCPKHAVRCDGVVDCKLKSDELGCVRFDWDKSLLKIYSGSSHQWLPICSSNWN
DSYSEKTCQQLGFESAYRTTEVAHRDFANSFSILRYNSTIQESLHRSECPSQRYISLQCS
HCGLRAMTGRIVGGALASDSKWPWQVSLHFGTTHICGGTLIDAQWVLTAAHCFFVTREKV
LEGWKVYVGTSNLHQLPEAASIAEIIINSNYTDEEDDYDIALMRLSKPLTLSAHIHPACL
PMHGQTFSLNETCWITGFGKTRETDDKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMM
CAGDLRGGRDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQRNKPGVYTKVTEVLPWIY
SKMESEVRFRKS
Download sequence
Identical sequences A0A2I3RY54
9598.ENSPTRP00000047622 ENSPTRP00000047622 ENSPTRP00000047622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]