SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047656 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047656
Domain Number 1 Region: 47-368
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.79e-121
Family Bee venom hyaluronidase 0.0000192
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000047656
Domain Number - Region: 429-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0136
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047656   Gene: ENSPTRG00000019642   Transcript: ENSPTRT00000036383
Sequence length 480
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:125364838:125393546:1 gene:ENSPTRG00000019642 transcript:ENSPTRT00000036383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLSERQLKLCVVQPVHLTSWLLIFFILKSISCLKPARLPIYERKPFIAAWNAPTDQCL
IKYNLRLNLKMFPVIGSPLAKARGQHVTIFYVNRLGYYPWYTSQGVPINGGLPQNISLQV
HLEKADQDINYYIPAEDFSGLAVIDWEYWRPQWARNWNAKDVYRQKSRKLISDMGKNVSA
TDIEYLAKVTFEESAKAFMKETIKLGIKSRPKGLWGYYLYPDCHNYNVYAPNYTGSCPED
EVLRNNELSWLWNSSAALYPSIGVWKSLGDSENILRFSKFRVHESMRISTMTSHDYALPV
FVYTRLGYRDEPLFFLSKQDLVSTIGESAALGAAGIVIWGDMNLTSSKANCTKVKQFVSS
DLGSYIANVTRAAEVCSLHLCRNNGRCIRKMWNAPSYLHLNPASYHIEASEDGEFTVKGK
ASDTDLAVMADTFSCHCYQGYEGADCREIKTADGCSGVSPSPGSLMTLCLLLLASYSIQL
Download sequence
Identical sequences ENSPTRP00000047656 ENSPTRP00000047656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]