SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047678 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047678
Domain Number 1 Region: 101-340
Classification Level Classification E-value
Superfamily Caspase-like 2.99e-75
Family Caspase catalytic domain 0.00000019
Further Details:      
 
Domain Number 2 Region: 9-87
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000159
Family Caspase recruitment domain, CARD 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047678   Gene: ENSPTRG00000028413   Transcript: ENSPTRT00000055218
Sequence length 341
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:102753843:102765769:-1 gene:ENSPTRG00000028413 transcript:ENSPTRT00000055218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEKPSNGVLVHMVKLLIKTFLDGIFDDLMENNVLNTDEIHLIGKCLKFVVSNAENLVD
DITETAQIAGKIFREHLWNSKKQLSSDISSDGERGANMPGLNICNKEFNYLHNRNGSELD
LLGMRDLLENLGYSVVIKENLTAQEMETALRQFAAHPEHQSSDSTFLVFMSHGILNGICG
TKHWDQEPDVLHDDTIFEIFNNRNCQSLKDKPKVVIMQACRGNGAGIVWFTTDSGKASAD
THGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHETNGSVFISQIIYYFKEYSWS
HHLEEIFRKVQHSFETLNILTQLPTIERLSMTRYFYLFPGN
Download sequence
Identical sequences H2R503
9598.ENSPTRP00000047678 ENSPTRP00000047678 ENSPTRP00000047678 XP_522166.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]