SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047706 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047706
Domain Number 1 Region: 256-399
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-33
Family cAMP-binding domain 0.000000205
Further Details:      
 
Domain Number 2 Region: 122-253
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.28e-33
Family cAMP-binding domain 0.000000174
Further Details:      
 
Domain Number 3 Region: 2-42
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000942
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047706   Gene: ENSPTRG00000019574   Transcript: ENSPTRT00000036258
Sequence length 405
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:108528967:108648718:1 gene:ENSPTRG00000019574 transcript:ENSPTRT00000036258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQHENERKGTARFGHEGRTWGD
LGAAAGGGTPSKGVNFAEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRI
IHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYV
IDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFR
RIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDGEQIIAQGDSADSF
FIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKC
LAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
Download sequence
Identical sequences ENSPTRP00000047706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]