SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047773 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047773
Domain Number 1 Region: 270-455
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-59
Family SPRY domain 0.0000138
Further Details:      
 
Domain Number 2 Region: 40-150
Classification Level Classification E-value
Superfamily Immunoglobulin 5.86e-17
Family V set domains (antibody variable domain-like) 0.00038
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000047773
Domain Number - Region: 163-242
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000387
Family C1 set domains (antibody constant domain-like) 0.037
Further Details:      
 
Domain Number - Region: 247-280
Classification Level Classification E-value
Superfamily BAG domain 0.0228
Family BAG domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047773   Gene: ENSPTRG00000017646   Transcript: ENSPTRT00000055302
Sequence length 485
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:182199491:182213877:1 gene:ENSPTRG00000017646 transcript:ENSPTRT00000055302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDLPVSLDSLKPVSLTSSLVFLMHLLLLQPGEPSSEVEVLGPEHPILALVGEEVEFPCH
LWPQLDAQQMEICWFRSHTLNVVHLYQEQQELPGRQMQAFRNRTKLVKDDIAYGSVVLQL
HSIVPSDKGIYGCRFHSDNFSGEALWELEVAALGSDPHLSLEGFKEGGIQLRLRSSGWYP
KPKVQWRDHQGQCLPPEFEAIVWDAQGLFSLETSVVVREGALSNVSVSIQNLLLSQKKEF
VVQIAEKLTAELEKLQTELDWRRAEGQAEWRAAQKYAVDVTLDPASAHPSLEVSEDGKSV
SSRGAPPGPAPGHPQRFSEQTCALSLERFSAGRHYWEVHVGRRSRWFLGACLAAVPRAGP
ARLSPAAGYWVLGLWNGCEYFVLAPHRVALALRVPPRRLGVFLDYEAGKLSFFNVSDGSH
IFTFHDTFSGALCAYFRPRAHDGGEHPDPLTICPLRVRGTRVPEENDSDTWLQPYEPADP
ALDWW
Download sequence
Identical sequences ENSPTRP00000047773 ENSPTRP00000047773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]