SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047777 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047777
Domain Number 1 Region: 280-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-53
Family SPRY domain 0.0000252
Further Details:      
 
Domain Number 2 Region: 21-131
Classification Level Classification E-value
Superfamily Immunoglobulin 3.23e-18
Family V set domains (antibody variable domain-like) 0.00015
Further Details:      
 
Domain Number 3 Region: 140-221
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000961
Family I set domains 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047777   Gene: ENSPTRG00000017644   Transcript: ENSPTRT00000055306
Sequence length 500
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:182058494:182112464:1 gene:ENSPTRG00000017644 transcript:ENSPTRT00000055306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALMLSLVLSLLKLGSGQWQVFGPEKPVQALVGEDAAFSCFLSPKTNAEAMEVRFFRGQF
SSVVHLYRDGKDQPFMQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQS
YYQKAIWELQVSALGSVPLISIAGYVDRDIQLLCQSSGWFPRPTAKWKGPQGQDLSTDSR
TNRDMHGLFDVEISLTVQENAGSISCSMQHAHLSQEVESRVQIGDTFFEPISWHLATKVL
GILCCGLFFGIVGLQIFFSKFQGKIQAELDWRRKHGQAELRDARKHAVEVTLDPETAHPQ
LCVSNLKTVTERKAPQDVPHSEKRFTRKSVVASQSFQAGKHYWEVDGGHNKRWRVGVCRD
DVDRRKEYVTLSPDHGYWVLRLNGEHLYFTLNPRFISVFPRTPPTKIGVFLDYECGTISF
FNINDQSLIYTLTCRFEGLLRPYIEYPSYNEQNGTPIVICPVTQESEREASWQRASTIPE
TSNSESSSQATTPFLPRGDV
Download sequence
Identical sequences H2R534
ENSPTRP00000047777 9598.ENSPTRP00000047777 ENSPTRP00000047777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]