SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047783 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047783
Domain Number 1 Region: 33-311
Classification Level Classification E-value
Superfamily L domain-like 1.08e-45
Family Ngr ectodomain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047783   Gene: ENSPTRG00000028468   Transcript: ENSPTRT00000055312
Sequence length 353
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:74561353:74577029:1 gene:ENSPTRG00000028468 transcript:ENSPTRT00000055312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPWPLLLLLAVSGAQTTRPCFPGCQCEVETFGLFDSFSLTRVDCSGLGPHIMPVPIPLDT
AHLDLSSNRLEMVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGL
TALPAESFTSSPLSDVNLSHNQLWEVSVSAFTTHSQGRALHVDLSHNLIHRLVPDPTRAG
LPAPTIQSLNLAWNRLHAVPNLRDLPLRYLSLDGNPLAVIGPGAFTGLGGLTHLSLASLQ
RLPELAPNGFRELPGLQVLDLSGNPKLNWAGAEVFSGLSSLQELDLSGTNLVPLPEALLL
HLPALQSISVGQDVRCRRLVREGTYPRRPGSTPKVALQWVDTGESAARGPTIL
Download sequence
Identical sequences ENSPTRP00000047783 ENSPTRP00000047783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]