SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047896 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047896
Domain Number 1 Region: 389-598
Classification Level Classification E-value
Superfamily VPS9 domain 6.67e-36
Family VPS9 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 56-162
Classification Level Classification E-value
Superfamily SH2 domain 6.46e-16
Family SH2 domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047896   Gene: ENSPTRG00000003919   Transcript: ENSPTRT00000007319
Sequence length 783
Comment pep:known chromosome:CHIMP2.1.4:11:64292208:64296573:-1 gene:ENSPTRG00000003919 transcript:ENSPTRT00000007319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPGESGVGSPGAPSPSSFTTGHLAREKPAQDPLYDVPNASGGQAGGPQRPGRVVSLRE
RLLLTRPVWLQLQANAAAALHMLRTEPPGTFLVRKSNTRQCQALCMRLPEASGPSFVSSH
YILESPGGVSLEGSELMFPDLVQLICAYCHTRDILLLPLQLPRAIHHAATHKELEAISHL
GIEFWSSSLNIKAQQGPAGGPVLPQLKARSPQELDQGTGAALCFFNPLFPGDLGPTKREK
FKRSFKVRVSTETSSPLSPPAVPPPPVPVLPGAVPSQTERLPPCQLLRRESSVGYRVPAG
SGPSLPPMPSLQEVDCGSPSSSEEEGVPGSQGSPATSPHLDRRRPLLRSMSTAFCSLLAP
ERQVGRAAAALMQDRHTAAGQLVQDLLTQVRAGPEPQELQGIRQALSRARAMLSAELGPE
KLLSPKRLEHVLEKSLHCSVLKPLRPILAARLRRRLAADGSLGRLAEGLRLARAQGPGAF
GSHLSLPSPVELEQVRQKLLQLLRTYSPSAQVKRLLQACKLLYMALRTQEGEGAGADEFL
PLLSLVLAHCDLPELLLEAEYMSELLEPSLLTGEGGYYLTSLSASLALLSGLGQAHTLPL
SPVQELRRSLSLWEQRRLPATHCFQHLLRVAYQDPSSGCTSKTLAVPPEASIATLNQLCA
TKFRVTQPNTFGLFLYKEQGYHRLPPGALAHRLPTTGYLVYRRAEWPETQGAATEEEGSG
QSEARSRGEEQGCQGDGDAGVKASPRDIREQSETTAEGGQGQAQEGPAQPGEPEAEGSRA
AEE
Download sequence
Identical sequences H2R578
ENSPTRP00000047896 XP_003313195.1.37143 XP_003828715.1.60992 ENSPTRP00000047896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]