SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047910 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047910
Domain Number 1 Region: 187-295
Classification Level Classification E-value
Superfamily SRCR-like 6.8e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 2 Region: 55-162
Classification Level Classification E-value
Superfamily SRCR-like 1.29e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 471-574
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 4 Region: 342-446
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047910   Gene: ENSPTRG00000019322   Transcript: ENSPTRT00000035754
Sequence length 575
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:76456950:76477282:-1 gene:ENSPTRG00000019322 transcript:ENSPTRT00000035754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKEAEMLIGPQLDEKRWGWRLGDGSAATPFLPPALSFLLLLPLASALQPTPLPFQELRL
VGGPSRCRGRLEVMHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPRPLAFGQGRGPI
LLDNVECRGQEAALSECGSRGWGVHNCFHYEDVAVLCDEFLPTQPPTRKMLTSRAPPTTL
PNGKSEGSVRLVGGANLCQGRVEILHSGLWGTVCDDDWGLPDAAVVCRQLGCGAAMAATT
NAFFGYGTGHILLDNVHCEGGEPRLAACQSLGWGVHNCGHHEDAGALCAGLSPPTLMALP
SSATREDWAWQTDPSATGVGPQPSRETTLLTTAAWAAGKKSGRLRLVGGPGPCRGRVEVL
HAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLDNVGCAGTEARL
SDCFHLGWGQHNCGHHEDAGALCAGPEELGLQVQQDGSETTRVPTPRPRDGHLRLVNGAH
RCEGRVELYLGQRWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFGPGRGPILLDNV
KCRGEESALLLCSHIRWDAHNCDHSEDASVLCQPS
Download sequence
Identical sequences H2R585
ENSPTRP00000047910 ENSPTRP00000047910 XP_016801314.1.37143 XP_016814291.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]