SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048004 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048004
Domain Number 1 Region: 100-372
Classification Level Classification E-value
Superfamily L domain-like 1.79e-48
Family Ngr ectodomain-like 0.0036
Further Details:      
 
Domain Number 2 Region: 53-120
Classification Level Classification E-value
Superfamily L domain-like 0.000000544
Family Ngr ectodomain-like 0.0037
Further Details:      
 
Domain Number 3 Region: 441-510
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000102
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048004   Gene: ENSPTRG00000028604   Transcript: ENSPTRT00000055495
Sequence length 674
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:62028681:62043132:1 gene:ENSPTRG00000028604 transcript:ENSPTRT00000055495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVAHPTATATTTPTATVTATVVMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRC
DNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDE
FPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLK
LLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIA
DDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLD
LSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGP
EKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLR
LPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSI
TETLVQGDKTEYLLTALEPKSTYIICMVTMETGNAYVADETPVCAKAETADSYGPTTTLN
QEQNAGPMASLPLAGIIGGAVALVFLFLVLGAICWYVHQAGELLTRERAYNRGSRKKDDY
MESGTKKDNSILEIHGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKATHTIGYGTTRG
YRDGGIPDIDYSYT
Download sequence
Identical sequences H2R5B4
XP_003313089.1.37143 XP_009421605.1.37143 XP_016776620.1.37143 ENSPTRP00000048004 ENSPTRP00000048004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]