SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048059 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048059
Domain Number 1 Region: 30-139
Classification Level Classification E-value
Superfamily SRCR-like 7.06e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.011
Further Details:      
 
Domain Number 2 Region: 271-373
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000353
Family Scavenger receptor cysteine-rich (SRCR) domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000048059
Domain Number - Region: 165-270
Classification Level Classification E-value
Superfamily SRCR-like 0.00017
Family Hepsin, N-terminal domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048059   Gene: ENSPTRG00000003729   Transcript: ENSPTRT00000006958
Sequence length 495
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:58929361:58954989:1 gene:ENSPTRG00000003729 transcript:ENSPTRT00000006958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVC
SQSWGRSSKQWEDPIQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHS
RNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGS
LGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQ
NSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAAL
CDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYC
KKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGP
TGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSRLSAYPALEGALHRSSTQPD
NSSDSDYDLHGAQRL
Download sequence
Identical sequences H2R5E0
XP_001138219.3.37143 ENSPTRP00000048059 9598.ENSPTRP00000048059 ENSPTRP00000048059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]