SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048131 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048131
Domain Number 1 Region: 46-177
Classification Level Classification E-value
Superfamily L domain-like 5.1e-25
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048131   Gene: ENSPTRG00000028653   Transcript: ENSPTRT00000055598
Sequence length 287
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:15107871:15164426:1 gene:ENSPTRG00000028653 transcript:ENSPTRT00000055598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWDPNPVPRTLRCWRLRRASETALQRSRRAVEDQLKICGHKRDADVFELFLSKKELTEV
VDLSRFKKLKYLWLHHNKLHGITFLTRNYCLTELYLNNNAIFEIEGLHYLPSLHILLLHH
NELTNIDATVKELKGMLNLKILSLYQNPLCQYNLYRLYIIYHLPGVELLDRNQVTEKERR
SMITIFNHKKAHIVQSIAFGGKVDASWDPKSPFKQKPAQRVPSDFAFANNVDKTVLDDPE
DAVFVRSMKRSVMTLTSMNWDTVPTREERYLEEEGTEPAQMLTVTLR
Download sequence
Identical sequences H2R5G7
9598.ENSPTRP00000048131 XP_001150272.2.37143 XP_016812601.1.37143 ENSPTRP00000048131 ENSPTRP00000048131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]