SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048194 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048194
Domain Number 1 Region: 1-252
Classification Level Classification E-value
Superfamily L domain-like 1.97e-53
Family Ngr ectodomain-like 0.0055
Further Details:      
 
Domain Number 2 Region: 175-422
Classification Level Classification E-value
Superfamily L domain-like 1.16e-35
Family Ngr ectodomain-like 0.014
Further Details:      
 
Domain Number 3 Region: 473-768
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.01e-34
Family Rhodopsin-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048194   Gene: ENSPTRG00000028697   Transcript: ENSPTRT00000055655
Sequence length 889
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:27238603:27283891:-1 gene:ENSPTRG00000028697 transcript:ENSPTRT00000055655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPS
EAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQAL
TLALNKISSIPDFAFTNLSSLVVLHLHNNKIKSLSQHCFDGLDNLETLDLNYNNLGEFPQ
AIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLV
IRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFN
GCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSF
NELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANL
NTEDNSLQDHGVAQEKGTADAANVTSTVENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIR
LTVWFIFLVALFFNLLVILTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAVSW
GRFAEFGIWWETGSGCKVAGFLAVFSSESAIFLLMLATVERSLSAKDIMKNGKSNHLKQF
RVAALLAFLGATVAGCFPLFHRGEYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLLMA
IIYTKLYCNLEKEDLSENSQSSLIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPEIM
KSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLKRRVTKKSGSVSVSISSQGGCLEQDFY
YDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCGTQ
SAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD
Download sequence
Identical sequences ENSPTRP00000048194 9598.ENSPTRP00000048194 ENSPTRP00000048194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]