SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048231 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048231
Domain Number 1 Region: 220-567
Classification Level Classification E-value
Superfamily ARM repeat 1.22e-26
Family Armadillo repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048231   Gene: ENSPTRG00000003391   Transcript: ENSPTRT00000055677
Sequence length 579
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:14908579:15041783:1 gene:ENSPTRG00000003391 transcript:ENSPTRT00000055677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRPPGNGEAASKGPGGWGLWGVQESRRLCCAGHDRCGQALLQIGINMMALPGGRHLDSV
TLPGQRLHLMQVDSVQRWMEDLKLMTECECMCVLQAKPISLEEDAQGDLILAGGPGPGDP
LQLLLKRGWVISTELRRIGQKLAQDRWARVHSMSVRLTCHARSMVSEYSAVSRNSSKEMG
QIEKLLMEKCSELSAVTERCLQVENEHVLKSMKACVSETLSTLGQHFGQLLELALTREVQ
ALVRKIDASDNIYTTESTTGNLFSLTQEGAPLCRIIAKEGGVVALFKVCRQDSFRCLYPQ
ALRTLASICCVEEGVHQLEKVDGVLCLADILTDDSHSEATRAEAAAVVAQVTSPHLPVTQ
HLSSFLESMEEIVTALVKLCQEASSGEVFLLASAALANITFFDTMACEMLLQLNAIRVLL
EACSDKQRVDTPYTRDQIVTILANMSVLEQCASDIIQENGVQLIMGMLSEKPRSGTPAEV
AACERVQQKAAVTLARLSRDPDVAREAVRLSCMSRLIELCRSPSERNSSDAVLVACLAAL
RRLAGVCPEGLQDSDFQQLVQPRLVDSFLLCSNMEESFV
Download sequence
Identical sequences H2R5K1
9598.ENSPTRP00000048231 XP_001172337.1.37143 ENSPTRP00000048231 ENSPTRP00000048231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]