SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048337 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048337
Domain Number 1 Region: 26-176
Classification Level Classification E-value
Superfamily L domain-like 1.16e-23
Family Internalin LRR domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048337   Gene: ENSPTRG00000003120   Transcript: ENSPTRT00000005951
Sequence length 482
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:572512:584954:1 gene:ENSPTRG00000003120 transcript:ENSPTRT00000005951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QALARVDDLRLVRALEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQ
VLWLARCGLADLDGIASLPALKELYASYNNISDLSPLCLLEQLEVLDLEGDPVEDLGVRY
LLLCPRLAMLTLEGNLVCLQPAPGPTNKVPRGYNYRAEVRKLIPQLQVLDEVPATHTGPP
APPRLSQDWLAVKEAIKKGNGLPPLDCPRGAPIRRLDPELSLPETQSRASRPWPFSLLVH
GGLLPEGLLSEDLAPEDNTSSLTHGAGQVLCGNPTKGLRERRHQCQAREPPEQLPQHRPG
DPAASTSTPEPDPADSSDFLALTGLRAWREHGVRPLPYRHPESQQEGAVAPWGPRRVPEE
QVHQAEPKTPSSPPSLASEPSGTSSQHLVPSPPKHPRPRDSGSSSPRWSTDLQSRGRRLR
ALGSWGPGLGDGVAAVPVLRALEVASGLSPRAQGRPGPKPAPDATARPPRAAELSHPSPV
PT
Download sequence
Identical sequences ENSPTRP00000048337 ENSPTRP00000048337 9598.ENSPTRP00000048337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]