SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048475 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048475
Domain Number 1 Region: 88-272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-60
Family SPRY domain 0.0000000114
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000919
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048475   Gene: ENSPTRG00000028879   Transcript: ENSPTRT00000055887
Sequence length 287
Comment pep:novel chromosome:CHIMP2.1.4:19:60700654:60702028:1 gene:ENSPTRG00000028879 transcript:ENSPTRT00000055887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHFKQVIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDD
IKPKYKLRALVSIIKELEPKLKKVLTMNPRMRKFQVDMTLDVDTANNYLIISEDLRSFRS
GDLSHNRKEQAERFDTALCVLGTPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIEL
SSEHGFLTVGCREGKVFAASTVPMTPLWVSPQLHRVGIFLDVGMRSIAFYNGSDGCHIYT
FIEIPVCEPWRPFFAHKRGSQDDQSILSICPVINPASASAPVSSGGK
Download sequence
Identical sequences 9598.ENSPTRP00000048475 ENSPTRP00000048475 ENSPTRP00000048475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]