SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048512 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048512
Domain Number 1 Region: 350-452
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000183
Family I set domains 0.025
Further Details:      
 
Domain Number 2 Region: 196-300
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000126
Family I set domains 0.03
Further Details:      
 
Domain Number 3 Region: 510-592
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000494
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048512   Gene: ENSPTRG00000011378   Transcript: ENSPTRT00000021171
Sequence length 701
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:56219754:56229878:-1 gene:ENSPTRG00000011378 transcript:ENSPTRT00000021171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTPQALPLFLLLASLVGILTLRASSGLQQTNFSSAFSSDSKSSSQGLGVEVPSIKPPSW
KVPDQFLDSKASAGISDSSWFPEALSSNMSGSFWSNVSAEGQDLSPVSPFSETPGSEVFP
DISDPQVPAKDPRPSFTVKTPASNISTQVSNTKLSVEAPDSKFSPDDMDLKLSAQSPESK
FSAETHSAASFPQQVGGPLAVLVGTTIRLPLVPIPNPGPPTSLVVWRRGSKVLAAGGLGP
GAPLISLDPAHRDHLRFDQARGVLELASAQLDDAGVYTAEVIRAGVSQQTHEFTVGVYEP
LPQLSVQPKAPETEEGAAELRLRCLGWGPRGGELSWSRDGRALDAALAHFVSASSKVTLR
CAAASRPPADITWSLADPAEAAVPAGSRLLLPAVGPGHAGTYACLAANPRTGRRRRSLLN
LTVADLPPGAPQCSVEGGPGDRSLRFRCSWPGGAPAASLQFQGLPEGIRAGPVSSVLLAA
VPAHPRLSGVPITCLARHLVATRTCTVTPEAPREVLLHPLVAETRLGEAEVALEASGCPP
PSRASWAREGRPLAPGGGSRLRLSQDGRKLHIGNFSLDWDLGNYSVLCSGALGAGGDQIT
LIGPTLSHGAIAGIVLGSLLGLALLAVLLLLCICCLCRFRGKTPEKKKHPSTLVPVVTPS
EKKMHSVTPVEISWPLDLKVPLEDHSSTRAYQAQTPVQLSL
Download sequence
Identical sequences ENSPTRP00000048512 ENSPTRP00000048512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]