SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048521 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048521
Domain Number 1 Region: 227-490
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-75
Family Protein kinases, catalytic subunit 0.00000000602
Further Details:      
 
Domain Number 2 Region: 119-261
Classification Level Classification E-value
Superfamily SH2 domain 9.96e-36
Family SH2 domain 0.00000267
Further Details:      
 
Domain Number 3 Region: 60-143
Classification Level Classification E-value
Superfamily SH3-domain 1.6e-20
Family SH3-domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048521   Gene: ENSPTRG00000019991   Transcript: ENSPTRT00000037044
Sequence length 590
Comment pep:known_by_projection scaffold:CHIMP2.1.4:GL390916.1:3439727:3462938:1 gene:ENSPTRG00000019991 transcript:ENSPTRT00000037044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPLPDEHLDEDK
HFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLE
MERWFFRSLGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIR
SLDEGGYYISPRIAFPSLQALVQHYSKKGDGLCQRLTLPCVSPAPQNPWAQDEWEIPRQC
LRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKALQHERLVRLY
AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAYIERMNSIHRD
LRAANILVSEALCCKIADFGLARIIDSEYTAQEGAKFPFKWTAPEAIHFGVFTIKADVWS
FGVLLMEVVTYGRVPYPGMSNPEVIRNLERGYRMPRPDTCPPELYRGVIAECWRSRPEER
PTFDCILGRVTRPLCAASFVEGCNSDLARSSRVLSPSKVFRTGKRLSSSMVPVLGTPRAG
RVPASAPCVDPALPRCRSQTGSRGRQQGQPQPRLRSSTAGLFCNKVTSVR
Download sequence
Identical sequences ENSPTRP00000048521 ENSPTRP00000048521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]