SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048579 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048579
Domain Number 1 Region: 4-150
Classification Level Classification E-value
Superfamily EF-hand 5.2e-42
Family Calmodulin-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048579   Gene: ENSPTRG00000011222   Transcript: ENSPTRT00000020854
Sequence length 152
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:52928368:52939052:-1 gene:ENSPTRG00000011222 transcript:ENSPTRT00000020854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELIELGQQIRMNLG
GRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLAELQQAMQRLLGER
LTPREISEVVREADVNGDGTVDFEEFVKMMSR
Download sequence
Identical sequences A0A0D9S2P3
ENSPTRP00000048579 ENSMMUP00000023586 ENSMMUP00000023586 9544.ENSMMUP00000023586 9598.ENSPTRP00000048579 ENSPTRP00000048579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]