SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048665 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048665
Domain Number 1 Region: 90-184
Classification Level Classification E-value
Superfamily F-box domain 1.2e-19
Family F-box domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048665   Gene: ENSPTRG00000013006   Transcript: ENSPTRT00000056028
Sequence length 188
Comment pep:known chromosome:CHIMP2.1.4:2B:235163954:235253104:1 gene:ENSPTRG00000013006 transcript:ENSPTRT00000056028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWLPETLFETVGQGPPPSKDYYQLLVTRSQVIFRWWKISLRSEYRSTKPGEAKETHED
FLENSHLQGQTALIFGARILDYVINLCKGKFDFLERLSDDLLLNIISYLDLEDIARLCQT
SHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGWRQLFFTNKLQLQRQLRKRKQKY
GNLREKQP
Download sequence
Identical sequences A0A2I3S946
ENSPTRP00000048665 ENSPTRP00000048665 9598.ENSPTRP00000048665 XP_001139272.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]