SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048765 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048765
Domain Number 1 Region: 106-186,233-336,379-488
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.19e-25
Family WD40-repeat 0.0062
Further Details:      
 
Domain Number 2 Region: 410-666
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000117
Family WD40-repeat 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000048765
Domain Number - Region: 916-1029
Classification Level Classification E-value
Superfamily ARM repeat 0.000173
Family GUN4-associated domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048765   Gene: ENSPTRG00000029026   Transcript: ENSPTRT00000056111
Sequence length 2830
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:43085469:43109883:-1 gene:ENSPTRG00000029026 transcript:ENSPTRT00000056111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPRLIPLWKDLKLLLNDTINKSKQPSEDPKNCLVVLSDRSQVLFKESRYPQNMPCVCY
YFSDAHFFASLSWVTSNTKEIQAVAWMKSKTEDMVEKRTFSMTERLPPIQSMVHAGSFHI
LVVYCGDLILRLFGDHFRAFKPLGKVPCRFNISCLCYDPEMKMLLSGILGAVVTWVIERG
GTGLQIAHMVSMPGDELVQDIVLNGPSGSLLALCETVVRVLMHQGKGQLGEVKRFTSTSS
GSSITCCFTCFDQGFLYAGNQAGEIQVWSLQQGHPLHSFQAHQSGVICIRSRPEAHTLLT
AGSDSLIKEWNLTSGSLLRRLELGEELNRLQFIDSITFFCQTAHSFSLHRLPCFYSLFNV
CGSAPQQLRRVYCGNNWFRILCTTEDGLLRFVSPVTGDLLVITWPFSILDRAVDWAYDPG
KEELFVATGSSEVLVFDTTRCPCPAKYLLGTSPNSQDFVQCLAYGHFNLGRGLEGLIFSG
HQSGVIRVLSQHSCARLEKFMHFGAVLALSTLSGGIFGGQGNSLLCSYGMDDYVHLSEAV
LDGVKVQLRPLASILSSCHLTHLILLPKSVGAITETNCLRLWKFHDFLSSGSQNGLKFIE
TLPLHLCAITSFDVCLSLSLFVTGSADGSVRIWDFHGRLIAILDSSLHFGPVCFANDRGD
LLVTFNQSLYLVSCLKLLPPALLTHLSFMSISDEVLEVPKPFIPSFFFSFETMFVPKYIY
PGQAQQKLVGLEKLVNNRAIAFDHSVPHVIEEDEEGSPVLLRSSMHYSLQDMEDWMQVSK
HYQCHYVLPPQLQLTSWDGLNPYQILRYYFGRGREWLFAPDCYIPNSVIRARLWPEGTPI
YLQCNLHAPQRELEWDRSQEFFFWHSRVRAISNTEYPKKKEEDEHFLEMRLSKDVTYSVL
TDGANRSWLGRKMTEITINSMIETMLNIMVHASLLKYQCCVGALGQIFASYQVSPALRSE
TARRLLDDTTNSNPLIRELAWEGLKRLGMITHLFAMPLAQGLMDKDERVRIKTLSLMAEI
GIHSRTSLLQLTQKQETFREMQQQMIGEEPLDHLLGMRATDLQILSTQVEQRLNENLTLS
HRDEKPAFSLDVSMPSELKSSLKPPTVSEESEVAIKPSKGQRRGRAGVKKHSQKWLRGLK
KTKERDSKQMSTEPGLLEDKSGTEAAPIEMEETSVYSKWSSRTSVIKLSKDVDSQEKDIS
KDHIALTLKRPQKIRDKRDKKATAQKLKKKHKKKGKEAKVINEETTPPVMEQPVTKKVKI
QGRGASGISGRRSTAGDGSSWRDDLCRLMTLRISGSQTKMSENLNAELVTFAQETLVDRH
PSWELFQEICPLLKKESKVLLEDLDWDVVPPEKKPIFIQEGAIREDMIQGVTQEVIRHKE
VMPREEEQAQKKARDMLGLEETQVILKKGKKVIFLEPGNVTMGKEISKKEEKKTFQKSPK
QGRKAVQKERKVGKIKREMTKEERDMSEEVEEMATLEEKVVKQEGKLVMIERTPSWQDWK
KAWDEWKQVHGETRKSWKAWKEEWEKRLLQEEEKLHQAGAKLSPEEEMLQEDKKLKWEEW
KQVWENMLSSKSKEQQYKDEEEVTLEEEVSREGEEKEQQVTEEQRQIQEEHKRARIHRKR
ARAEKKRAQEERKLAQEEEKLAQEERQLAQEKRKLAQAYMKITQDDREMAQAEGKIAQKE
ETLAQRGEKLSQEAEKLAQKRKKLAKKWEKVAREEENLAKKGGKLGEVKNILAKLAQEEE
LLFQEKEKLAQRNEKMPEEEERLGRKREQFIGKKMKLAHKRERWINSMEELSQNKMILYQ
KKNLAQEKKNLAQEKEKLAQRKENLLYNKERLTHSKKQLVQVKNKLGMFKKILAQVEEKL
TQEKETVIKKKEKLAETEKKLVQVEDSLAKKQEKLAQEKMKLALEKAMVQGKKRLRGELD
IAKEEKALNLEMKRLAEEKMRLVEGKETLSKGETPETSRQRKMTQVEQELFERKLSLEEK
ILLHEDRILAMEESEIAKGKLEFTRGQRIFVQGQRKLAKASRKLIKKRESLSKEPAKLNK
ILKALQKLTRDERKLTQEEIKMTKMRRALFVKEHRLSIEQSKLDIKEWDFSEKRSELTKD
EKKLARKQRKLANEMRRMINKEEKMTEEEGKLARKHSEVILDDEEEGGIEEEEVIPFLKR
RWRKRKEAKRVDKPKEKFSSQVDEVESEEHFSEEMESLLDELEKQESLSSEEEEEREEEE
EREEEEREEEEGEEKQVEKEEEEERKKKKEKKKEEVQEKEEVFEEKEEIMSEEETESLSD
EEEEEESCSLEEEVDRETEILKKEKQFKLQDQRRKSLRGRERFLSILRGVPHGPGRAIRL
GVLKSPLKKLMSTALEMKEKTPVPVPEKQISWEDKKATVVEIPRKFLGTMDKEREVMGKY
EPIPPHVLGTVLESQAQDLKTPFMSHILRRTVEAEELQHKPLGAWWKWFLQHPPLMGQTE
VQLPLSQIPAKEQHADVSLSDVEWIRHVLERMEAGEQLSRDGFHRLCQLLKDLASKGNLE
WLHLAKLEAIVYRHRQALESQDTRISSRQSMSPKYLKVIPPIKAKEKESWPKPLAVPTQK
SPLATKRIPDPRAKNWHLLGEPYRSERAQQISIAHKEMEMQYFYPAARDIFPSAHASVEK
QTLALMFQKDFWDFKDKRRFPKLPKLEKKTQPISKKKEELPLWETFVALYHVLRMLQQRY
PKDSTAWMEQFYQLMDLYQLKSPRIQKLLQELLMREEPQSQEIIYEEALKATELVPGERL
FCCLFCGSSHTPRSPQEFQGAIPLPWQNCVRTILPVGIARYGILELAWKSLPEADLHLTK
ALTHTVAPTL
Download sequence
Identical sequences ENSPTRP00000048765 ENSPTRP00000048765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]