SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048819 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048819
Domain Number 1 Region: 298-494
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.08e-47
Family Reprolysin-like 0.00026
Further Details:      
 
Domain Number 2 Region: 511-586
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.71e-17
Family Blood coagulation inhibitor (disintegrin) 0.00052
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000048819
Domain Number - Region: 742-770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.046
Family Integrin beta EGF-like domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048819   Gene: ENSPTRG00000012846   Transcript: ENSPTRT00000056160
Sequence length 832
Comment pep:known chromosome:CHIMP2.1.4:2B:211282829:211458673:1 gene:ENSPTRG00000012846 transcript:ENSPTRT00000056160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPGSSSRQPPLAGCSLAGASCGPQRGPAGSVPASAPARTPPCRLLLVLLLLPPLAASS
RPRAWGAAAPSAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYY
INQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEI
HYENGKPQYSKGGEHCYYHGSIRGVKDSKVALSTCNGLHGMFEDDTFVYMIEPLELVHDE
KSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQWLKRRKRAVNPSRGIFEEMKY
LELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDQID
ITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYG
LPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEY
RDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHC
SDGPCCNNTSCLFQPRGYECRDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCY
NGECKTRDNQCQYIWGTKAAGSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFL
LCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMC
LDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNLHPP
KDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI
Download sequence
Identical sequences A0A024R3W8 A0A2I3T091 O75077
ENSPTRP00000048819 ENSP00000264377 ENSPTRP00000048819 9606.ENSP00000264377 ENSP00000264377 ENSP00000264377 NP_003803.1.87134 NP_003803.1.92137 XP_516049.3.37143 gi|4501913|ref|NP_003803.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]