SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049006 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049006
Domain Number 1 Region: 116-258
Classification Level Classification E-value
Superfamily L domain-like 1.26e-31
Family U2A'-like 0.031
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000049006
Domain Number - Region: 1822-2055
Classification Level Classification E-value
Superfamily Tropomyosin 0.000602
Family Tropomyosin 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049006   Gene: ENSPTRG00000021311   Transcript: ENSPTRT00000039417
Sequence length 2325
Comment pep:known chromosome:CHIMP2.1.4:9:120122638:120212926:1 gene:ENSPTRG00000021311 transcript:ENSPTRT00000039417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKGSQQKIFSKAKIPSSSHSPIPSSMSNMRSRSLSPLIGSETLPFHSGGQWCEQVEIAD
ENNMLLDYQDHKGADSHAGVRYITEALIKKLTKQDNLALIKSLNLSLSKDGGKKFKYIEN
LEKCVKLEVLNLSYNLIGKIEKLDKLLKLRELNLSYNKISKIEGIENMCNLQKLNLAGNE
IEHIPVWLGKKLKSLRVLNLKGNKISSLQDISKLKLLQDLISLILVENPVVTLPHYLQFT
IFHLRSLESLEGQPVTTQDRQEAFERFSLEEVERLERDLEKKMIETEELKSKQTRFLEEI
KNQDKLNKSLKEEAMLQKQSCEELKSDLNTKNELLKQKTIELTRACQKQYELEQELAFYK
IDAKFEPLNYYPSEYAEIDKAPDESPYIGKSRYKRNMFATESYIIDSAQAVQIKKVEPDE
QLRNDHMNLRGHTPLDTQLEDKEKKISAAQTRLSELHDEIEKAEQQILRATEEFKQLEEA
IQLKKISEAGKDLLYKQLSGRLQLVNKLRQEALDLELQMEKQKQEIAGKQKEIKDLQIAI
DSLDSKDPKHSHMKAQKRGKEQQLDIMNKQYQQLESRLDEILSRIAKETEEIKDLEEQLT
EGQIAANEALKKDLEGVISGLQEYLGTIKGQATQAQNECRKLRDEKETLLQRLTEVEQER
DQLEIVAMDAENMRKELAELESALQEQHEVNASLQQTQGDLSAYEAELEARLNLRDAEAN
QLKEELEKVTRLTQLEQSALQAELEKERQALKNALGKAQFSEEKEQENSELHAKLKHLQD
DNNLLKQQLKDFQNHLNHVVDGLVRPEEVAARVDELRRKLKLGTGEMNIHSPSDVLGKSL
ADLQKQFSEILARSKWERDEAQVRERKLQEEMALQREKLATGQEEFRQACERALEARMNF
DKRQHEARIQQMENEIHYLQENLKSMEEIQGLTDLQLQEADEEKERILAQLRELEKKKKL
EDAKSQEQVFGLDKELKKLKKAVATSDKLATAELTIAKDQLKSLHGTVMKINQERAEELQ
EAERFSRKAAQAARDLTRAEAEIELLQNLLRQKGEQFRLEMEKTGVGTEANSQVLEIEKL
NETMERQRTEIARLQNVLDLTGSDNKGGFENVLEEIAELRREVSYQNDYISSMADPFKRR
GYWYFMPPPPSSKVSSHSSQATKDSGVGLKYTASTPVRKPRPGQQDGKEGSQPPPASGYW
VYSPIRSGLHKLFPNRDADSGGDSQEESELDDQEEPPFVPPPGYMMYTVLPDGSPVPQGM
ALYAPPPPLPNNSRPLTPGTVVYGPPPAGAPMVYGPPPPNFSIPFIPMGVLHCNVPEHHN
LENEVSRLEDIMQHLKSKKREERWMRASKRQSEKEMEELHHNIDDLLQEKKSLECEVEEL
HRTVQKRQQQKDFIDGNVESLMTELEIEKSLKHHEDIVDEIECIEKTLLKRRSELREADR
LLAEAESELSCTKEKTKNAVEKFTDAKRSLLQTESDAEELERRAQETAVNLVKADQQLRS
LQADAKDLEQHKIKQEEILKEINKIVAAKDSDFQCLSKKKEKLTEELQKLQKDIEMAERN
EDHHLQVLKESEVLLQAKRAELEKLKSQVTSQQQEMAVLDRQLGHKKEELHLLQGSMVQA
KADLQEALRLGETEVTEKCNHIREVKSLLEELSFQKGELNVQISERKTQLTLIKQEIEKE
EENLQVVLRQMSKHKTELKNILDMLQLENHELQGLKLQHDQRVSELEKTQVAVLEEKLEL
ENLQQISHQQKGEIEWQKQLLERDKREIEQMTAESRALQSCVECLSKEKEDLQEKCDIWE
KKLAQTKRVLAAAEENSKMEQSNLEKLELNVRKLQQELDQLNRDKLSLHNDISAMQQQLQ
EKREAVNSLQEELANVQDHLNLAKQDLLHTTKHQDVLLSEQTRLQKDISEWANRFEDCQK
EEETKQQQLQVLQNEIEENKLKLVQQEMMFQRLQRERESEESKLETSKVTLKEQQHQLEK
ELTDQKSKLDQVLSKVLAAEERVRTLQEEERWGESLEKTLSQTKRQLSEREQQLVEKSGE
LLALQKEADSMRADFSLLRNQFLTERKKAEKQVASLKEALKIQRSQLEKNLLEQKQENSC
MQKEMATIELVAQDNHERARRLMKELNQMQYEYTELKKQMANQKDLERRQMEISDAMRTL
KSEVKDEIRTSLKNLNQFLPELPADLEAILERKENLEGELESLKENLPFTMNEGPFEEKL
NFSQVHIMDEHWRGEALREKLRHREDRLKAQLRHCMSKQAEVLIKGKRQTEGTLHSLRRQ
VDALGELVTSTSADSASSPSLSQLESSLTEDSQLGQNQEKNASAR
Download sequence
Identical sequences H2R6D0
ENSPTRP00000049006 XP_016817050.1.37143 ENSPTRP00000049006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]