SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049039 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049039
Domain Number 1 Region: 2007-2141
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.43e-18
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 2 Region: 1929-2000
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.4e-18
Family TB module/8-cys domain 0.0000915
Further Details:      
 
Domain Number 3 Region: 829-897
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.15e-17
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 4 Region: 993-1130
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.83e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 1406-1478
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.23e-16
Family TB module/8-cys domain 0.0000603
Further Details:      
 
Domain Number 6 Region: 593-729
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.38e-16
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 534-607
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.75e-16
Family TB module/8-cys domain 0.00058
Further Details:      
 
Domain Number 8 Region: 1727-1852
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.82e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 9 Region: 180-265
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.4e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 10 Region: 2214-2283
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.53e-16
Family TB module/8-cys domain 0.00049
Further Details:      
 
Domain Number 11 Region: 1565-1631
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000017
Family TB module/8-cys domain 0.00059
Further Details:      
 
Domain Number 12 Region: 906-1036
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000173
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 13 Region: 726-810
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000196
Family TB module/8-cys domain 0.002
Further Details:      
 
Domain Number 14 Region: 2371-2502
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000267
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 15 Region: 1242-1372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000068
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 16 Region: 1484-1539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000155
Family EGF-type module 0.00077
Further Details:      
 
Domain Number 17 Region: 451-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000469
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 18 Region: 1117-1173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000629
Family EGF-type module 0.008
Further Details:      
 
Domain Number 19 Region: 2325-2380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000753
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 20 Region: 1886-1934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000105
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 21 Region: 1644-1769
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000141
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 22 Region: 489-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000455
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 23 Region: 1362-1409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000805
Family EGF-type module 0.0004
Further Details:      
 
Domain Number 24 Region: 1158-1215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000106
Family EGF-type module 0.012
Further Details:      
 
Domain Number 25 Region: 2286-2339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family EGF-type module 0.011
Further Details:      
 
Domain Number 26 Region: 373-457
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000022
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 27 Region: 1844-1888
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000156
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 28 Region: 2486-2583
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000235
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 29 Region: 1206-1244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000033
Family EGF-type module 0.026
Further Details:      
 
Domain Number 30 Region: 2169-2217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000407
Family EGF-type module 0.004
Further Details:      
 
Domain Number 31 Region: 2128-2165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000155
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000049039
Domain Number - Region: 152-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0321
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 120-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0718
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049039   Gene: ENSPTRG00000010415   Transcript: ENSPTRT00000019141
Sequence length 2732
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:8197091:8278203:-1 gene:ENSPTRG00000010415 transcript:ENSPTRT00000019141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLEGLYLARGPLARLLLAWSALLCMAGGQGRWDGALQAAGPGRVWRRGSPGILQGPNVC
GSRFHAYCCPGWRTFPGRSQCVVPICRRACGEGFCSQPNLCTCADGTLAPSCGVSRGSGC
SVSCMNGGTCRGASCLCQKGYTGTVCGQPICDRGCHNGGRCIGPNRCACVYGFMGPQCER
DYRTGPCFGQVGPEGCQHQLTGLVCTKALCCATVGRAWGLPCELCPAQPHPCRRGFIPNI
HTGACQDVDECQAVPGLCQGGSCVNMVGSFHCRCPVGHQLSDSSTACEWAAAPIPELCPP
RGSNEFQQLCAQRLPLLPGHPGLFPGLLGFGSNGMGPPLGPARLNPHGSDARGIPSLGPG
NSNIGTATLNQTIDICRHFTNLCLNGRCLPTPSSYRCECNVGYTQDVRGECIDVDECTSS
PCHHGDCVNIPGTYHCRCYPGFQAMPTRQACVDVDECIVSGGLCHLGRCVNTEGSFQCVC
NAGFELSPDGKNCVDIDECQTPGICVNGHCTNTEGSFRCQCLGGLAVGTDGRVCVDTHVR
STCYGAIEKGSCARPFPGTVTKSECCCANPDHGFGEPCQLCPAKNSAEFQALCGSGLGIT
TDGRDINECALDPEVCANGVCENLRGSYRCVCNLGYEAGASGKDCTDMDECALNSLLCDN
GWCHNSPGSYSCSCPPGFHFWQDTEICKDVDECLSSPCVNGVCQNLAGSYTCKCGPGSQL
DPSGTICLDSTKGTCWLKIQESRCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACAR
GFARMTGVTCDDVNECESFPGVCPNGRCINTAGSFRCECPEGLMLDASGRLCVDVRLEPC
FLRWDEDECGVTLPGKYRMDVCCCSLGAAWGAECEACPDPESLEFASLCPRGLGFASRDF
LSGRPFYKDVNECKVFPGLCTHGTCRNTVGSFHCACVGGFALDAQEWNCTDIDECCISPD
LCGQGTCVNTPGSFECECFPGYESGFMLMKDCMDVDECARDPLLCRGGTCTNTDGSYKCQ
CPPGRELTAEGTACEDIDECSLRDGLCPHGQCVNVIGAFQCSCYAGFQGTPDRQGCVDIN
ECRVQNGGCDVHCINTEGSYRCSCGQGYSLMPDGRACADVDECEENPRVCDQGHCTNMPG
GHRCLCYDGFMATPDMRTCVDVDECDLNPHICLHGDCENTKGSFVCHCQLGYMVRKGATG
CSDVDECEVGGHNCDSHASCLNIPGSFSCRCLPGWVGDGFECHDLDECVSQEHRCSPRGD
CLNVPGSYRCTCRQGFAGDGFSCEDRDECAENVDLCDNGQCLNAPGGYRCECEMGFDPTE
DHRACQDVDECAQGNLCAFGSCENLPGMFRCICNGGYELDRGGGNCTDINECADPVNCIN
GVCINTPGSYLCSCPQDFELNPSRVGCVDTRAGNCFLETHDRGDGGISCSAEIGVGVTRA
SCCCSLGRAWGNPCELCPMTNTTEYRTLCPGGEGFRPNRITVILEDIDECQELPGLCQGG
DCVNTFGSFQCECPPGYHLSEHTRICEDIDECSTHSGICGPGTCYNTLGNYTCVCPAEYL
QVNGGNNCMDMRKSVCFRHYNGTCQNELAFNVTRKMCCCSYNIGQAWNRPCEACPTPTSP
DYQILCGNQAPGFLIDIHTGKPLDIDECGEIPAICANGICINQIGSFRCECPAGFNYNSI
LLACEDVDECGSRESPCQQNADCINIPGSYHCECTRGYKLSPGGACVGRNECREIPNVCS
HGDCMDTEGSYMCLCHRGFQASADQTLCMDIDECDRQPCGNGTCKNIIGSYNCLCFPGFV
VTHNGDCVDFDECTTLVGQVCRFGHCLNTAGSFHCLCQDGFELTADGKNCVDTNECLSLA
GTCLPGTCQNLEGSFRCICPPGFQVQSDHCIDIDECSEEPNLCLFGTCTNSPGSFQCLCL
PGFVLSDNGHRCFDTRQSFCFTRFEAGKCSVPKAFNTTKTRCCCSKRPGEGWGDPCELCP
QEGSAAFQELCPFGHGAVPGPDDSREDVNECTENPGVCTNGICVNTDGSFRCECPFGYSL
DFTGINCVDTDECSVGHPCGQGTCTNVIGGFECACADGFEPGLMMTCEDIDECSLNPLLC
AFRCHNTEGSYLCTCPAGYTLREDGAMCRDVDECADGQQDCHARSMECKNLIGTFACVCP
PGMRPLPGSGEGCTDDNECQAQPDLCVNGRCVNTAGSFRCDCDEGFQPSPTLTECHDIRQ
GPCFAEVLQTTCRSLSSSSEAVTRAECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGY
TAEGRDVDECRMLAHLCAHGECINSLGSFRCHCRAGYTPDATATTCLDMDECSQVPKPCT
FLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDECTSRQHNCQFLCVNTVGTFTCRCPPGFT
QRHQACFDNDECSAQPGPCGARGHCHNTPGSFRCECHQGFTLDSSGHGCEDVNECDGPHR
CQHGCQNQLGGYRCGCPQGFTQHSQWAQCVDENECALSPPTCGSASCRNTLGGFRCVCPS
GFDFDQALGGCQDVDECAGRRGPCSYSCANTPGGFLCGCPQGYFRAGQGHCVSGLGFSPG
PQDTLDKEELLSSEACYECKINGLSPRDRPRRSAHRDHQVNLATLDSEALLTLGLNLSHL
GRAERILELRPALEGLEGRIRYVIVRGNEQGFFRMHHLRGVSSLRLGRRRPGPGTYRLEV
VSHMAGPWGVQPEGQPGPRGQALRLKVQLQLL
Download sequence
Identical sequences ENSPTRP00000049039 ENSPTRP00000049039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]