SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049062 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049062
Domain Number 1 Region: 177-247
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 2 Region: 237-297
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000598
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Domain Number 3 Region: 124-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000123
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 4 Region: 39-158
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000157
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049062   Gene: ENSPTRG00000021262   Transcript: ENSPTRT00000046426
Sequence length 491
Comment pep:known chromosome:CHIMP2.1.4:9:111036637:111116983:-1 gene:ENSPTRG00000021262 transcript:ENSPTRT00000046426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGPWDAGPSRRLLPLLLLLGLARGAAGAPGPDGLDVCATCHEHATCQQREGKKICICN
YGFVGNGRTQCVDKNECQFGATVVCGNHTSCHNTPGGFYCICLEGYRATNNNKTFIPNDG
TFCTDIDECEVSGLCRHGGRCVNTHGSFECYCMDGYLPRNGPEPFHPTTDATSCTEIDCG
TPPEVPDGYIIGNYTSRLGSQVRYACREGFFSVPEDTVSSCTALGTWESPKLHCQEINCG
NPPEMRHAILVGNHSSRLGGVARYVCQEGFESPGGKITSVCTEKGTWRESTLTCTEILTK
INDVSLFNDTCVRWQINSRRINPKISYVISIKGQRLDPMESVREETVNLTTDSRTPEVCL
ALYPGTNYTVNISTAPPRRSMPAVIGFQTAEVDLLEDDGSFNISIFNETCLKLNRRSRKV
GSEHMYQFTVLGQRWYLANFSHATSFNFTTREQVPVVCLDLYPTTDYTVNVTLLRSPKRH
SVQITIATPPA
Download sequence
Identical sequences ENSPTRP00000049062 ENSPTRP00000049062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]