SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049082 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049082
Domain Number 1 Region: 1424-1624
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-40
Family Pentraxin (pentaxin) 0.00077
Further Details:      
 
Domain Number 2 Region: 79-259
Classification Level Classification E-value
Superfamily vWA-like 2.36e-39
Family Integrin A (or I) domain 0.00066
Further Details:      
 
Domain Number 3 Region: 2144-2213
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-19
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 4 Region: 3239-3308
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.9e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 2773-2842
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.07e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 1787-1856
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-17
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 7 Region: 1961-2029
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 8 Region: 2379-2449
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-17
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 9 Region: 2831-2900
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.64e-17
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 10 Region: 2715-2784
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.2e-17
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 11 Region: 1845-1914
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.34e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 12 Region: 2263-2331
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 13 Region: 2496-2565
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1e-16
Family Complement control module/SCR domain 0.00092
Further Details:      
 
Domain Number 14 Region: 1688-1746
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.36e-16
Family Complement control module/SCR domain 0.00061
Further Details:      
 
Domain Number 15 Region: 2889-2958
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.39e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 16 Region: 2554-2621
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.03e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 17 Region: 2671-2726
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.59e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 18 Region: 1903-1968
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.59e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 19 Region: 3416-3475
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 20 Region: 3063-3130
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 21 Region: 3298-3364
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000375
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 22 Region: 2438-2507
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000598
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 23 Region: 437-504
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000195
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 24 Region: 1631-1699
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000445
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 25 Region: 2948-3010
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000089
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 26 Region: 1294-1420
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000298
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 27 Region: 376-447
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000709
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 28 Region: 2322-2390
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000101
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 29 Region: 2204-2268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000125
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 30 Region: 3007-3073
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 31 Region: 2018-2086
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000334
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 32 Region: 3357-3425
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000723
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 33 Region: 3121-3188
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000118
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 34 Region: 987-1131
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000314
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 35 Region: 3181-3244
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000208
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 36 Region: 2083-2150
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000347
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 37 Region: 1230-1274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000695
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 38 Region: 1195-1236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000757
Family EGF-type module 0.015
Further Details:      
 
Domain Number 39 Region: 1741-1784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000389
Family EGF-type module 0.054
Further Details:      
 
Domain Number 40 Region: 496-553
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000057
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Domain Number 41 Region: 277-433
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000116
Family Growth factor receptor domain 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000049082
Domain Number - Region: 3467-3503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000168
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 3506-3535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000322
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 3535-3566
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000474
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 727-789
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000846
Family Complement control module/SCR domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049082   Gene: ENSPTRG00000021246   Transcript: ENSPTRT00000056360
Sequence length 3571
Comment pep:known chromosome:CHIMP2.1.4:9:109302697:109511800:-1 gene:ENSPTRG00000021246 transcript:ENSPTRT00000056360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPRLAFCCWGLALVSGWATFQQMSPSRNFSFRLFPETAPGAPGSIPAPPAPGDEAAGSR
VERLGQAFRRRVRLLRELSERLELVFLVDDSSSVGEVNFRSELMFVRKLLSDFPVVPTAT
RVAIVTFSSKNYVVPRVDYISTRRARQHKCALLLQEIPAISYRGGGTYTKGAFQQAAQIL
LHARENSTKVIFLITDGYSNGGDPRPIAASLRDSGVEIFTFGIWQGNIRELNDMASTPKE
EHCYLLHSFEEFEALARRALHEDLPSGSFIQDDMVHCSYLCDEGKDCCDRMASCKCGTHT
GHFECICEKGYYGKGLQYECTACPSGTYKPEGSPGGISSCIPCPDENHTSPPGSTSPEDC
VCREGYRASGQTCELVHCPALKPPENGYFIQNTCNNHFNAACGVRCHPGFDLVGSSIILC
LPNGLWSGSESYCRVRTCPHLRQPKHGHISCSTREMLYKTTCLVACDEGYRLEGSDKLTC
QGNSQWDGPEPRCVERQCSTFQTPKDVIISPHNCGKQPAKFGTICYVSCRQGFILSGVKE
MLRCTTSGKWNVGVQAAVCKDVEAPQINCPKDIEAKTLEQQDSANVTWQIPTAKDNSGEK
VSVHVHPAFTPPYLFPIGDVAIVYTATDLSGNQASCIFHIKVIDAEPPVIDWCRSPPPVQ
VSEKVHAASWDEPQFSDNSGAELVITRSHTQGDLFPQGETIVQYTATDPSGNNRTCDIHI
VIKGSPCEIPFTPVNGDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTY
TTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLGKMVPSFCSDAEDI
DCRLEENLTKKYCLEYNYDYENGFAIGPGGWGAANRLDYSYDDFLDTVQETATSIGNARS
SRIKRSAPLSDYKIKLIFNITASVPLPDERNDTLEWENQQRLLQTLETITNKLKRTLNKD
PMYSFQLASEILIADSNSLETKKASPFCRPGSVLRGRMCVNCPLGTYYNLEHFTCESCRI
GSYQDEEGQLECKLCPSGMYTEYIHSRNISDCKAQCKQGTYSYSGLETCESCPLGTYQPK
FGSRSCLSCPENTSTVKRGAVNISACGVPCPEGKFSRSGLMPCHPCPRDYYQPNAGKAFC
LACPFYGTTPFAGSRSITECSSFSSTFSAAEESVVPPASLGHIKKRHEISSQVFHECFFN
PCHNSGTCQQLGRGYVCLCPLGYTGLKCETDIDECSPLPCLNNGVCKDLVGEFICECPSG
YTGQRCEENINECSSSPCLNKGICVDGVAGYRCTCVKGFVGLHCETEVNECQSNPCLNNA
VCEDQVGGFLCKCPPGFLGTRCGKNVDECLSQPCKNGATCKDGANSFRCLCAAGFTGSHC
ELNINECQSNPCRNQATCVDELNSYSCKCQPGFSGKRCETEQSTGFNLDFEVSGIYGYVM
LDGVLPSLHALTCTFWMKSSDDMNYGTPISYAVDNGSDNTLLLTDYNGWVLYVNGREKIT
NCPSVNDGRWHHIAITWTSANGIWKVYIDGKLSDGGAGLSVGLPIPGGGALVLGQEQDKK
GEGFSPAESFVGSISQLNLWDYVLSPQQVKSLATSCPEELSKGNVLAWPDFLSGIVGKVK
IDSKSIFCSDCPRLGGSVPHLRTASEDLKPGSKIHLFCDPGFQLVGNPVQYCLNQGQWTQ
PLPHCERISCGVPPPLENGFHSADDFYAGSTVTYQCNNGYYLLGDSRMFCTDNGSWNGVS
PSCLDVDECAVGSDCSEHASCLNVDGSYICSCVPPYTGDGKNCAEPIKCKAPGNPENGHS
SGEIYTVGAEVTFSCQEGYQLMGVTKITCLASGEWNHLIPYCKAVSCGKPAIPENGCIEE
LAFTFGSKVTYRCNKGYTLAGDKESSCLANSSWSHSPPVCEPVTCSSPENINNGKYILSG
LTYLSTASYSCNTGYSLQGPSIIECTASGIWDRAPPACHLVFCGEPPAIKDAVITGNNFT
FRNTVTYTCKEGYTLAGLDTIECLADGKWSRSDQQCLAVSCDEPPIVDHASPETAHRLFG
DIAFYYCSDGYSLADNSQLLCNAQGKWVPPEGQDMPRCIAHFCEKPPSVSYSILESVSKA
KFAAGSVVSFKCMEGFVLNTSAKIECMRGGQWNPSPMSIQCIPVRCGEPPSIMNGYASGS
NYSFGAMVAYSCNKGFYIKGEKKSTCEATGQWSSPIPTCHPVSCGEPPKVENGFLEHTTG
RIFESEVRYQCNPGYKSVGSPVFVCQANRHWHSESPLMCVPLDCGKPPPIQNGFMKGENF
EVGSKVQFFCNEGYELVGDSSWTCQKSGKWNKKSNPKCVPAKCPEPPLLENQLVLKELTT
EVGVVTFSCKEGHVLQGPSVLKCLPSQQWNDSFPVCKMVLCTPPPLISFGVPVPSSALHF
GSTVKYSCVGGFFLRGNSTTLCQPDGTWSSPLPECVPVECPQPEEIPNGIIDVQGLAYLS
TALYTCKPGFELVGNTTTLCGENGHWLGGKPRCKAIECLKPKEILNGKFSYTDLHYGQTV
TYSCNRGFRLEGPSALTCLETGDWDVDAPSCNAIHCDSPQPIENGFVEGADYSYGAIIIY
SCFPGFQVAGHAMQTCEESGWSSSIPTCMPIDCGLPPHIDFGDCTKLKDDQGYFEQEDDM
MEVPYVTPHPPYHLGAVAKTWENTKESPATHSSNFLYGTIVSYTCNPGYELLGNPVLICQ
EDGTWNGSAPSCISIECDLPTAPENGFLRFTETSMGSAVQYSCKPGHILVGSDLRLCLEN
RKWSGASPRCEAISCKKPNPIMNGSIKGSNYTYLSTLYYECDPGYVLNGTERRTCQDDKN
WDEDEPICIPVDCGSPPVSANGQVRGDEYTFQKEIEYTCNEGFLLEEARSRVCLANGSWS
GATPDCVPVRCATPPQLANGVMEGLDYGFMKEVTFHCHEGYILHGAPKLTCQSDGNWDAE
IPLCKPVNCGPPEDLAHGFPNGFSFIHAGHLQYQCFPGYKLHGNSSRRCLSNGSWSGSSP
SCLPCRCSTPVIEYGTVNGTDFDCGKAARIQCLKGFKLLGLSEITCEANGQWSSGFPHCE
HTSCGSLPMIPNAFISETSSWKENVITYSCRSGYVIQGSSDLICTEKGVWSQPYPVCEPL
SCGSPPSVANAVATGEAHTYESEVKLRCLEGYTMDTDTDTFTCQKDGRWFPERISCSPKK
CPLPENITHILVHGDDFSVNRQVSVSCAEGYTFEGVNISVCQLDGTWEPPFSDESCSPVS
CGKPESPEHGFVVGSKYTFESTIIYQCEPGYELEGNRERVCQENRQWSGGVAICKETRCE
TPLEFLNGKADIENRTTGPNVVYSCNRGYSLEGPSEAHCTENGTWSHPVPLCKPNPCPVP
FVIPENALLSEKEFYVDQNVSIKCREGFLLQGHGIITCNPDETWTQTSAKCEKISCGPPA
HVENAIARGVRYQYGDMITYSCYSGYMLEGSLRSVCLENGTWTSPPICRAVCRFPCQNGG
ICQRPNACSCPEGWMGRLCEEPICILPCLNGGRCVAPYQCDCPPGWTGSRCHTAVCQSPC
LNGGKCVRPNRCHCLSSWTGHNCSRKRRTGF
Download sequence
Identical sequences H2R6G0
ENSPTRP00000049082 XP_520182.3.37143 ENSPTRP00000049082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]