SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049148 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049148
Domain Number 1 Region: 1165-1331
Classification Level Classification E-value
Superfamily C-type lectin-like 5.65e-77
Family Endostatin 0.0000000558
Further Details:      
 
Domain Number 2 Region: 40-236
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.33e-35
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 3 Region: 812-971
Classification Level Classification E-value
Superfamily C-type lectin-like 1.51e-26
Family Endostatin 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049148   Gene: ENSPTRG00000029189   Transcript: ENSPTRT00000056412
Sequence length 1337
Comment pep:known_by_projection chromosome:CHIMP2.1.4:9:97744586:97874640:1 gene:ENSPTRG00000029189 transcript:ENSPTRT00000056412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRRNNGQCWCLLMLLSVSTPLPAVTQTRGATETASQGHLDLTQLIGVPLPSSVSFVTG
YGGFPAYSFGPGANVGRPARTLIPSTFFRDFAISVVVKPSSTRGGVLFAITDAFQKVIYL
GLRLSGVEDGHQRIILYYTEPGSHVSQEAAAFSVPVMTHRWNRFAMIVQGEEVTLLVNCE
EHSRLPFQRSSQALAFESSAGIFVGNAGATGLERFTGSLQQLTVHPDPRTPEELCDPEES
SASGETSGLQEADGVAEILEAVTYTQASPKEAKVEPINTPPTPSSPFEDMELSGEPVPEG
TPETTNMSIIQHSSPEQGSGEILNDTLEGVHSVDGDPITDSGSGAGAFLDIAEEKNLAAT
AAGLAEVPISTAGEAEASSVPTGGPTLSMSTENAEEGVTPGPSSEDSLTTAAAATEVSLS
TFEDEEASGVPTDGLAPLTATMAPEQAVTSGPGDEEDLAAATTEEPLITAGGEESGSPPP
DGPPLPLPTVAPERWVTPAQREHVGMKGQAGPKGEKGDAGEELPGPPEPSGPVGPTAGAE
AEGSGLGWGSDVGSGSGDLVGSEQLLRGPPGPPGPPGLPGIPGKPGTDVFMGPPGSPGED
GPAGEPGPPGPEGQPGVDGATGLPGMKGEKGARGPNGSVGEKGDPGNRGLPGPPGKKGQA
GPPGVMGPPGPPGPPGPPGPGCTMGLGFEDTEGSGSTQLLNEPKLSRPTAAIGLKGEKGD
RGPKGERGMDGASIVGPPGPRGPPGPIKVLSNSLINITHGFMNFSDIPELVGPPGPDGLP
GLPGFPGPRGPKGDTGLPGFPGLKGEQGEKGEPGAILTGDIPLERLMGKKGEPGMHGAPG
PMGPKGPPGHKGEFGLPGRPGRPGLNGLKGTKGDPGVIMQGPPGLPGPPGPPGPPGAVIN
IKGAIFPIPVRPHCKMPVDTAHPGSPELITFHGVKGEKGSWGLPGSKGEKGDQGAQGPPG
PPLDLSYLRHFLNNLKGENGDKGFKGEKGEKGDVNDSFLMSGPPGLPGNPGLAGQKGETV
VGPQGPPGAPGLPGPPGFGRPGDPGPPGPPGPPGPPAILGAAVALPGPPGPPGQPGLPGS
RNLVTAFSNMDDMLQKAHLVIEGTFIYLRDSTEFFIRVRDGWKKLQLGELIPIPADSPPP
PALSSNPHQLLPPPNPISSANYEKPALHLAALNMPFSGDVRADFQCFKQARAAGLLSTYR
AFLSSHLQDLSTIVRKAERYSLPIVNLKGQVLFNNWDSIFSGHGGQFNMHIPIYSFDGRD
VMTDPSWPQKVIWHGSSPHGIRLVDNYCEAWRTADTAVTGLASPLSTGKILDQKAYSCAN
RLIVLCIENSFMTDARK
Download sequence
Identical sequences 9598.ENSPTRP00000049148 ENSPTRP00000049148 ENSPTRP00000049148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]