SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049191 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049191
Domain Number 1 Region: 31-149
Classification Level Classification E-value
Superfamily Immunoglobulin 4.35e-51
Family I set domains 0.00000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049191   Gene: ENSPTRG00000010151   Transcript: ENSPTRT00000045958
Sequence length 324
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:409500:418523:1 gene:ENSPTRG00000010151 transcript:ENSPTRT00000045958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFGLALLLAGLLGLLLGRTLQHTLKVIVFAFPDQLTVSPAALVPGDPAVACTAHKVTPV
DPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPAL
YCQATMRLPGLELSHRQAIPALHALSNPEAPEAESPQAPPLSTPASCHPTSPEPPDTTSP
EPPDTTSPDPPDTTSPDPPDTTSPEPPDTTSPEPAPQQGSTHTPRSPGSTRTHRPEISQA
GPTQGEVIPTVSSKPAGDQLPTALWTSSAVLGLLLLALPTYHLWKRCRHLAEDDTHPPAS
LRLLPQVSAWAGLRGTGQVGISPS
Download sequence
Identical sequences ENSPTRP00000049191 ENSPTRP00000049191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]