SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049223 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049223
Domain Number 1 Region: 17-80
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000167
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000049223
Domain Number - Region: 74-133
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.022
Family Rhodopsin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049223   Gene: ENSPTRG00000021122   Transcript: ENSPTRT00000056472
Sequence length 241
Comment pep:novel chromosome:CHIMP2.1.4:9:91887160:91903154:1 gene:ENSPTRG00000021122 transcript:ENSPTRT00000056472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNIGLVMEWEIPEIICTCAKLRLPPQATFQVLRGNGASVGTVLMFHCPSNHQMVGSGLL
TCTWKGSIAEWSSGSPVCKLVPPHETFGFKVAVIASIVSCAIILLMSMAFLTCCLLKCVK
KSERRRSNRSAQLWSQLKDEDLTVQAAYLGLKHFNKPVSGPSQAHDNHSFTTDHGESTSK
LASVTRSVDKDPGIPRALSLSGSSSSPQAQVMVHMANPRQPLPASGLATGMPQQPAAYAL
G
Download sequence
Identical sequences ENSPTRP00000049223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]