SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049312 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049312
Domain Number 1 Region: 382-504
Classification Level Classification E-value
Superfamily SH2 domain 1.25e-27
Family SH2 domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049312   Gene: ENSPTRG00000020955   Transcript: ENSPTRT00000038768
Sequence length 509
Comment pep:known_by_projection chromosome:CHIMP2.1.4:9:38428359:38577078:-1 gene:ENSPTRG00000020955 transcript:ENSPTRT00000038768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATA
SCLSASSGSLPDDSGSSSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGSGE
PGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYIS
PKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKV
TIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTP
YEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKR
QSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDA
ENLLRLCKECSYLVRNSQTNKHDYSLSLKSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPE
VIHYYTTRKLPIKGAEHLSLLYPVAVRTL
Download sequence
Identical sequences ENSPTRP00000049312 ENSPTRP00000049312 9598.ENSPTRP00000049312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]