SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049501 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049501
Domain Number 1 Region: 59-281
Classification Level Classification E-value
Superfamily L domain-like 3.4e-40
Family Internalin LRR domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049501   Gene: ENSPTRG00000029358   Transcript: ENSPTRT00000056723
Sequence length 301
Comment pep:known_by_projection chromosome:CHIMP2.1.4:18:9364441:9365346:-1 gene:ENSPTRG00000029358 transcript:ENSPTRT00000056723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGARQSRASSKDKGPKRMLFTGRRQKFSPWDDALLSGRDPRSLLKRGMHHVSFSLVTRGM
TDIPDFLWGLSEVQKLNLSHNQLRVLPPEVGKLTRIVVLNLCGNRLKSLPREVSLLQCLK
VLFVNMNCLTEVPAELSLCRKLEVLSLSHNCLSQLPACFADLSRLRKLNLSNNFFAHIPM
CVFSLKELIFLHVGSNRLENIAESIQHLASLQIFIAEGNNIHSFPRSLCLVTSLELLNLN
NNDIQILPSELHLLCRLVRIAWNPMDKGLHISHNPLSKPLPELVEGGLEMLFGYLKDKKH
T
Download sequence
Identical sequences H2R6U7
ENSPTRP00000049501 XP_009431943.1.37143 XP_016788821.1.37143 ENSPTRP00000049501 9598.ENSPTRP00000049501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]