SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049619 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049619
Domain Number 1 Region: 196-577
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.62e-102
Family Phosphonoacetate hydrolase 0.017
Further Details:      
 
Domain Number 2 Region: 672-911
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4.88e-25
Family DNA/RNA non-specific endonuclease 0.011
Further Details:      
 
Domain Number 3 Region: 105-150
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000523
Family Somatomedin B domain 0.002
Further Details:      
 
Domain Number 4 Region: 151-191
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000824
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049619   Gene: ENSPTRG00000018603   Transcript: ENSPTRT00000034356
Sequence length 925
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:133115447:133202171:1 gene:ENSPTRG00000018603 transcript:ENSPTRT00000034356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERDGCAGGGSRGGEGGRAPREGPAGNGRDRGRSHAAEAPGDPQAAASLLAPMDLGEEPL
EKAVRARTAKDPNTYKVLSLVLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFGNC
RCDAACVELGNCCLDYQETCIEPEHIWTCNKFRCGEKRLTRSLCACSDDCKDQGDCCINY
SSVCQGEKSWVEEPCESINEPQCPAGFETPPTLLFSLDGFRAEYLHTWGGLLPVISKLKK
CGTYTKNMRPVYPTKTFPNHYSIVTGLYPESHGIIDNKMYDPKMNASFSLKSKEKFNPEW
YKGEPIWVTAKYQGLKSGTFFWPGSDVEINGIFPDIYKMYNGSVPFEERILAVLQWLQLP
KDERPHFYTLYLEEPDSSGHSYGPVSSEVIKALQRVDGMVGMLMDGLKELNLHRCLNLIL
ISDHGMEQGSCKKYIYLNKYLGDVKNIKVIYGPAARLRPSDVPDKYYSFNYEGIARNLSC
QEPNQHFKPYLKHFLPKRLHFAKSDRIEPLTFYLDPQWQLALNPSERKYCGSGFHGSDNV
FSNMQALFVGYGPGFKHGIEADTFENIEVYNLMCDLLNLTPAPNNGTHGSLNHLLKNPVY
MPKHPKEVHPLVQCPFTRNPRDNLGCSCNPSILPIEDFQTQFNLTVAEEKIIKHETLPYG
RPRVLQKKNTICLLSQHQFMSGYSQDILMPLWTSYTVDRNDSFSTEDFSNCLYQDFRIPL
SPVHKCSFYKNNTKVSYGFLSPPQLNKNSSGIYSEALLTTNIVPMYQSFQVIWRYFHDTL
LRKYAEERNGVNVVSGPVFDFDYDGRYDSLENLRQKRRVIRNQEILIPTHFFIVLTSCKD
TSQTPLHCENLDTLAFILPHRTDNSESCVHGKHDSSWVEELLMLHRARITDVEHITGLSF
YQQRKEPVSDILKLKTHLPTFSQED
Download sequence
Identical sequences ENSPTRP00000049619 ENSPTRP00000049619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]