SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049650 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049650
Domain Number 1 Region: 36-153
Classification Level Classification E-value
Superfamily TPR-like 9.97e-20
Family Tetratricopeptide repeat (TPR) 0.0081
Further Details:      
 
Domain Number 2 Region: 813-851
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000149
Family Classic zinc finger, C2H2 0.054
Further Details:      
 
Domain Number 3 Region: 865-899
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000275
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number 4 Region: 463-492
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000785
Family CCCH zinc finger 0.005
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000049650
Domain Number - Region: 736-768
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000153
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 592-623
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00235
Family CCCH zinc finger 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049650   Gene: ENSPTRG00000014424   Transcript: ENSPTRT00000026956
Sequence length 958
Comment pep:known chromosome:CHIMP2.1.4:22:40048615:40078594:1 gene:ENSPTRG00000014424 transcript:ENSPTRT00000026956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERQKRKADIEKGLQFIQSTLPLKQEEYEAFLLKLVQNLFAEGNDLFREKDYKQALVQYM
EGLNVADYAASDQVALPRELLCKLHVNRAACYFTMGLYEKALEDSEKALGLDSESIRALF
RKARALNELGRHKEAYECSSRCSLALPHDESVTQLGQELAQKLGLRVRKAYKRPQGTSNG
LGSIDDIETDCYVDPRGSPALLPSTPTMPLFPHVLDLLAPLDSSRTLPSTDSLDDFSDGD
VFGPELDTLLDSLSLVQGGLSGSGVPSELPQLIPVFPGGTPLLPPVVGGSIPVSSPLPPA
SFGLVMDPSKKLAASVLDALDPPGPTLDPLDLLPYSETRLDALDSFGSTRGSLDKPDSFM
EETNSQDHRPPSGAQKPAPSPEPCMPNTALLIKNPLAATHEFKQACQLCYPKTGPRAGDY
TYREGLEHKCKRDILLGRLRSSEDQTWKRIRPRPTKTSFVGSYYLCKDMINKQDCKYGDN
CTFAYHQEEIDVWTEERKGTLNRDLLFDPLGGVKRGSLTIAKLLKEHQGIFTFLCEICFD
SKPRIISKGTKDSPSVCSNLAAKHSFYNNKCLVHIVRSTSLKYSKIRQFQEHFQFDVCRH
EVRYGCLREDSCHFAHSFIELKVWLLQQYSGMTHEDIVQESKKYWQQMEAHAGKASSSMG
APRTHGPSTFDLQMKFVCGQCWRNGQVVEPDKDLKYCSAKARHCWTKERRVLLVMSKAKR
KWVSVRPLPSIRNFPQQYDLCIHAQNGRKCQYVGNCSFAHSPEERDMWTFMKENKILDMQ
QTYDMWLKKHNPGKPGEGTPISSREGEKQIQMPTDYADIMMGYHCWLCGKNSNSKKQWQQ
HIQSEKHKEKVFTSDSDTSGWAFRFPMGEFRLCDRLQKGKACPDGDKCRCAHGQEELNEW
LDRREVLKQKLAKARKDMLLCPRDDDFGKYNFLLQEDGDLAGATPEGPAAAATATTGE
Download sequence
Identical sequences A0A2I3RWP8
XP_009436757.1.37143 ENSPTRP00000049650 ENSPTRP00000049650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]